Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316V4D0

Protein Details
Accession A0A316V4D0    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MFRKGKSARKDDRQRQRQPQPIESASHydrophilic
292-321DDWLHDVKYKKIRSRKGEKKKDGAQNGGPRBasic
NLS Segment(s)
PositionSequence
301-313KKIRSRKGEKKKD
Subcellular Location(s) nucl 14, cyto_nucl 10, mito 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MFRKGKSARKDDRQRQRQPQPIESASPSIVGTQGAGQPAGAVRGHTAGPRDPRPNTEPAKSQQPQPQHKGEAAATQSKVSFVHQAPPKSAPGHQHPSQHQASAHRPASSPNTSRGPISSVGSGERRPYVPGAFSGRRTLMSSSSEHGGTPPSSNSGSMTLVSSHNTAVPPPHHQQQRGIMMTMSDGVGGAIPCPSPAGGYPDPFSITGVRGGDEQEKLTYAQPPTSELHVPPPSSDVHSSTSSSWVSAMSASTGIVYGGPPLGNGHGANRATNPYKINHIYDEYASLGPEDDDWLHDVKYKKIRSRKGEKKKDGAQNGGPRIEYDVDRWRWRSCCCCSCRGIGECV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.93
3 0.93
4 0.91
5 0.88
6 0.85
7 0.83
8 0.76
9 0.7
10 0.62
11 0.55
12 0.46
13 0.39
14 0.31
15 0.23
16 0.2
17 0.14
18 0.12
19 0.11
20 0.13
21 0.12
22 0.12
23 0.11
24 0.11
25 0.12
26 0.14
27 0.11
28 0.09
29 0.09
30 0.11
31 0.13
32 0.14
33 0.16
34 0.2
35 0.27
36 0.34
37 0.4
38 0.4
39 0.46
40 0.49
41 0.54
42 0.54
43 0.52
44 0.52
45 0.49
46 0.58
47 0.53
48 0.56
49 0.53
50 0.58
51 0.62
52 0.62
53 0.65
54 0.57
55 0.56
56 0.53
57 0.47
58 0.43
59 0.37
60 0.36
61 0.3
62 0.28
63 0.26
64 0.23
65 0.23
66 0.19
67 0.22
68 0.17
69 0.25
70 0.29
71 0.31
72 0.33
73 0.36
74 0.37
75 0.33
76 0.35
77 0.33
78 0.36
79 0.42
80 0.43
81 0.48
82 0.47
83 0.53
84 0.51
85 0.47
86 0.41
87 0.39
88 0.41
89 0.42
90 0.41
91 0.35
92 0.34
93 0.34
94 0.39
95 0.39
96 0.36
97 0.32
98 0.34
99 0.33
100 0.34
101 0.31
102 0.27
103 0.23
104 0.22
105 0.18
106 0.15
107 0.16
108 0.18
109 0.18
110 0.17
111 0.17
112 0.16
113 0.16
114 0.17
115 0.15
116 0.14
117 0.16
118 0.22
119 0.22
120 0.23
121 0.24
122 0.23
123 0.23
124 0.24
125 0.22
126 0.17
127 0.18
128 0.18
129 0.17
130 0.17
131 0.17
132 0.15
133 0.14
134 0.13
135 0.12
136 0.11
137 0.1
138 0.11
139 0.11
140 0.11
141 0.11
142 0.11
143 0.11
144 0.1
145 0.1
146 0.09
147 0.1
148 0.11
149 0.1
150 0.09
151 0.09
152 0.09
153 0.09
154 0.1
155 0.11
156 0.15
157 0.18
158 0.25
159 0.27
160 0.28
161 0.31
162 0.35
163 0.4
164 0.35
165 0.33
166 0.26
167 0.22
168 0.21
169 0.18
170 0.12
171 0.05
172 0.04
173 0.04
174 0.04
175 0.04
176 0.04
177 0.04
178 0.04
179 0.04
180 0.04
181 0.04
182 0.04
183 0.05
184 0.12
185 0.13
186 0.14
187 0.15
188 0.16
189 0.17
190 0.17
191 0.17
192 0.11
193 0.1
194 0.12
195 0.11
196 0.11
197 0.1
198 0.12
199 0.13
200 0.13
201 0.13
202 0.11
203 0.11
204 0.12
205 0.13
206 0.16
207 0.14
208 0.15
209 0.15
210 0.17
211 0.18
212 0.2
213 0.21
214 0.17
215 0.24
216 0.25
217 0.25
218 0.23
219 0.23
220 0.21
221 0.22
222 0.23
223 0.18
224 0.19
225 0.2
226 0.21
227 0.2
228 0.23
229 0.2
230 0.18
231 0.16
232 0.12
233 0.11
234 0.1
235 0.09
236 0.06
237 0.06
238 0.06
239 0.06
240 0.06
241 0.05
242 0.05
243 0.05
244 0.05
245 0.05
246 0.05
247 0.05
248 0.06
249 0.07
250 0.08
251 0.09
252 0.1
253 0.15
254 0.16
255 0.17
256 0.18
257 0.23
258 0.24
259 0.27
260 0.28
261 0.24
262 0.31
263 0.34
264 0.35
265 0.32
266 0.33
267 0.32
268 0.3
269 0.3
270 0.25
271 0.21
272 0.19
273 0.15
274 0.13
275 0.11
276 0.1
277 0.1
278 0.08
279 0.09
280 0.1
281 0.12
282 0.11
283 0.16
284 0.18
285 0.24
286 0.33
287 0.4
288 0.47
289 0.56
290 0.65
291 0.71
292 0.8
293 0.84
294 0.86
295 0.89
296 0.9
297 0.9
298 0.9
299 0.9
300 0.86
301 0.83
302 0.8
303 0.78
304 0.75
305 0.68
306 0.59
307 0.49
308 0.45
309 0.41
310 0.33
311 0.29
312 0.32
313 0.36
314 0.43
315 0.46
316 0.47
317 0.49
318 0.54
319 0.58
320 0.58
321 0.61
322 0.6
323 0.64
324 0.62
325 0.64
326 0.65