Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316V223

Protein Details
Accession A0A316V223   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-26TQTPTRPTQHQQQHHQSSPFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 5.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038635  CCR4-NOT_su2/3/5_C_sf  
IPR040168  Not2/3/5  
IPR007282  NOT2/3/5_C  
Gene Ontology GO:0030015  C:CCR4-NOT core complex  
GO:0000289  P:nuclear-transcribed mRNA poly(A) tail shortening  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF04153  NOT2_3_5  
Amino Acid Sequences MQRPPGTQTPTRPTQHQQQHHQSSPFAGHQRPALPPGMNIGQTQSASGAGSVGNAAPGAPSGAPGLPGGMGSRMGFPPSGMGSPAAVRSMGPAGYAARSGGGSHGNTGAGSYLFAGGGGGGGAGSYGQGQGGGNLDMSDFPALGSAGAGVSQGQTSSLASTLSNAASRGGAASSGQGSGFTSDDFPALGAPSAAGGMTGGPQHFANGSQAQSAATAAAAAAAAEQASAAAALQHQASQREAHRLGMLSNVNGSPQAANRGTGQGQPPALNAARGGFGEMERNYATKLGSSQPTGMPALSTNTGGAQSWSQAEGGASNTNGTGARGTGPHPPSTTTPASQILYSPADRFGLIGLLRIIKLQAAGPGAGGVNGAPPEDVQMLALGTDLQTLGLDVGSEHPLYPDFHTPWSSDAHPLQRSQRSMVEPDFHLPSCYNVQPPPPAQTKVANFSDETLFFIFYSTPRDVLQEVAAMELHHRNWRFHKELQLWLTKEHNMEPTQKTPMYEKGQYVFWDVESWQRVTKNFVLLYELLEDRPALAAQAQAQQAQAMQQQQQQGGGPGGQAELQTAGAGAAPSTPSQVSTPAQTQAQPAGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.7
3 0.7
4 0.72
5 0.74
6 0.8
7 0.81
8 0.78
9 0.68
10 0.61
11 0.57
12 0.53
13 0.48
14 0.42
15 0.37
16 0.38
17 0.41
18 0.41
19 0.39
20 0.37
21 0.31
22 0.29
23 0.32
24 0.32
25 0.29
26 0.27
27 0.26
28 0.24
29 0.23
30 0.23
31 0.18
32 0.14
33 0.13
34 0.12
35 0.1
36 0.07
37 0.07
38 0.07
39 0.07
40 0.06
41 0.06
42 0.06
43 0.05
44 0.05
45 0.07
46 0.06
47 0.07
48 0.08
49 0.09
50 0.1
51 0.09
52 0.1
53 0.08
54 0.09
55 0.09
56 0.08
57 0.09
58 0.09
59 0.12
60 0.12
61 0.13
62 0.13
63 0.12
64 0.14
65 0.15
66 0.15
67 0.13
68 0.13
69 0.13
70 0.14
71 0.15
72 0.13
73 0.11
74 0.1
75 0.11
76 0.13
77 0.11
78 0.1
79 0.1
80 0.11
81 0.11
82 0.12
83 0.1
84 0.09
85 0.09
86 0.09
87 0.1
88 0.13
89 0.12
90 0.13
91 0.14
92 0.14
93 0.13
94 0.13
95 0.12
96 0.08
97 0.08
98 0.07
99 0.06
100 0.06
101 0.06
102 0.06
103 0.04
104 0.04
105 0.04
106 0.03
107 0.02
108 0.02
109 0.02
110 0.02
111 0.02
112 0.03
113 0.03
114 0.03
115 0.04
116 0.04
117 0.05
118 0.07
119 0.07
120 0.07
121 0.07
122 0.07
123 0.07
124 0.08
125 0.07
126 0.06
127 0.05
128 0.06
129 0.06
130 0.05
131 0.05
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.05
142 0.05
143 0.06
144 0.06
145 0.06
146 0.06
147 0.07
148 0.09
149 0.09
150 0.1
151 0.09
152 0.09
153 0.09
154 0.09
155 0.08
156 0.07
157 0.06
158 0.06
159 0.06
160 0.06
161 0.07
162 0.07
163 0.06
164 0.07
165 0.08
166 0.08
167 0.07
168 0.08
169 0.08
170 0.08
171 0.08
172 0.07
173 0.06
174 0.07
175 0.06
176 0.05
177 0.04
178 0.04
179 0.04
180 0.04
181 0.03
182 0.03
183 0.03
184 0.04
185 0.05
186 0.05
187 0.06
188 0.06
189 0.07
190 0.07
191 0.08
192 0.1
193 0.11
194 0.12
195 0.11
196 0.12
197 0.11
198 0.11
199 0.11
200 0.07
201 0.05
202 0.04
203 0.04
204 0.03
205 0.03
206 0.03
207 0.03
208 0.02
209 0.02
210 0.02
211 0.02
212 0.02
213 0.02
214 0.02
215 0.02
216 0.02
217 0.02
218 0.03
219 0.04
220 0.06
221 0.08
222 0.09
223 0.1
224 0.13
225 0.14
226 0.2
227 0.21
228 0.2
229 0.2
230 0.19
231 0.18
232 0.2
233 0.19
234 0.13
235 0.14
236 0.12
237 0.11
238 0.11
239 0.11
240 0.07
241 0.07
242 0.12
243 0.11
244 0.12
245 0.13
246 0.15
247 0.15
248 0.18
249 0.18
250 0.16
251 0.16
252 0.16
253 0.15
254 0.16
255 0.15
256 0.12
257 0.11
258 0.09
259 0.09
260 0.08
261 0.09
262 0.06
263 0.06
264 0.1
265 0.1
266 0.11
267 0.11
268 0.11
269 0.1
270 0.11
271 0.11
272 0.07
273 0.09
274 0.1
275 0.12
276 0.13
277 0.14
278 0.13
279 0.15
280 0.15
281 0.13
282 0.1
283 0.09
284 0.1
285 0.09
286 0.08
287 0.07
288 0.07
289 0.07
290 0.07
291 0.07
292 0.06
293 0.06
294 0.06
295 0.06
296 0.06
297 0.06
298 0.06
299 0.06
300 0.07
301 0.07
302 0.06
303 0.06
304 0.06
305 0.06
306 0.06
307 0.06
308 0.05
309 0.05
310 0.06
311 0.06
312 0.08
313 0.14
314 0.16
315 0.18
316 0.18
317 0.2
318 0.21
319 0.26
320 0.26
321 0.2
322 0.21
323 0.22
324 0.22
325 0.2
326 0.19
327 0.16
328 0.16
329 0.16
330 0.14
331 0.12
332 0.12
333 0.12
334 0.11
335 0.09
336 0.09
337 0.08
338 0.08
339 0.08
340 0.08
341 0.09
342 0.09
343 0.08
344 0.06
345 0.07
346 0.06
347 0.07
348 0.08
349 0.07
350 0.07
351 0.08
352 0.08
353 0.07
354 0.06
355 0.04
356 0.04
357 0.05
358 0.05
359 0.04
360 0.04
361 0.06
362 0.06
363 0.06
364 0.05
365 0.05
366 0.05
367 0.05
368 0.05
369 0.04
370 0.03
371 0.04
372 0.04
373 0.03
374 0.03
375 0.03
376 0.03
377 0.03
378 0.03
379 0.03
380 0.05
381 0.07
382 0.07
383 0.07
384 0.07
385 0.09
386 0.1
387 0.13
388 0.16
389 0.16
390 0.18
391 0.2
392 0.2
393 0.2
394 0.22
395 0.21
396 0.2
397 0.22
398 0.27
399 0.28
400 0.3
401 0.36
402 0.39
403 0.4
404 0.39
405 0.4
406 0.36
407 0.38
408 0.38
409 0.34
410 0.3
411 0.3
412 0.31
413 0.25
414 0.24
415 0.2
416 0.2
417 0.2
418 0.21
419 0.21
420 0.2
421 0.23
422 0.27
423 0.28
424 0.32
425 0.33
426 0.34
427 0.33
428 0.38
429 0.38
430 0.4
431 0.41
432 0.36
433 0.31
434 0.31
435 0.31
436 0.24
437 0.23
438 0.17
439 0.15
440 0.13
441 0.14
442 0.12
443 0.1
444 0.15
445 0.14
446 0.14
447 0.14
448 0.16
449 0.16
450 0.17
451 0.17
452 0.14
453 0.13
454 0.12
455 0.12
456 0.1
457 0.12
458 0.14
459 0.15
460 0.19
461 0.21
462 0.25
463 0.32
464 0.4
465 0.43
466 0.45
467 0.53
468 0.52
469 0.58
470 0.6
471 0.61
472 0.54
473 0.51
474 0.5
475 0.44
476 0.4
477 0.35
478 0.34
479 0.29
480 0.35
481 0.37
482 0.38
483 0.41
484 0.41
485 0.4
486 0.38
487 0.43
488 0.43
489 0.42
490 0.41
491 0.37
492 0.39
493 0.38
494 0.38
495 0.3
496 0.24
497 0.22
498 0.19
499 0.23
500 0.24
501 0.24
502 0.24
503 0.26
504 0.27
505 0.31
506 0.35
507 0.35
508 0.32
509 0.31
510 0.32
511 0.29
512 0.3
513 0.27
514 0.24
515 0.18
516 0.17
517 0.16
518 0.12
519 0.13
520 0.11
521 0.08
522 0.08
523 0.1
524 0.12
525 0.18
526 0.19
527 0.18
528 0.18
529 0.18
530 0.18
531 0.19
532 0.2
533 0.19
534 0.21
535 0.24
536 0.29
537 0.29
538 0.31
539 0.29
540 0.27
541 0.25
542 0.21
543 0.18
544 0.14
545 0.13
546 0.12
547 0.11
548 0.1
549 0.09
550 0.09
551 0.08
552 0.08
553 0.07
554 0.07
555 0.07
556 0.06
557 0.06
558 0.08
559 0.08
560 0.11
561 0.11
562 0.12
563 0.13
564 0.17
565 0.18
566 0.22
567 0.25
568 0.27
569 0.29
570 0.29
571 0.31