Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316UZ87

Protein Details
Accession A0A316UZ87    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
6-25AKITLTKHSRTKKKATTTISHydrophilic
NLS Segment(s)
PositionSequence
107-110KKGK
Subcellular Location(s) mito 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR046447  DENR_C  
IPR001950  SUI1  
IPR036877  SUI1_dom_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF01253  SUI1  
PROSITE View protein in PROSITE  
PS50296  SUI1  
CDD cd11607  DENR_C  
Amino Acid Sequences MRCQAAKITLTKHSRTKKKATTTISGLHFFSPPLPALKVISKGLASRLATGCSVSKSPSNPNVEEITIQGDVAEDVKDMILARQKPFNDLKEGDVSESQVKVEEEKKKGKGAGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.67
3 0.73
4 0.74
5 0.78
6 0.81
7 0.78
8 0.74
9 0.69
10 0.69
11 0.62
12 0.55
13 0.46
14 0.38
15 0.32
16 0.25
17 0.21
18 0.16
19 0.13
20 0.13
21 0.12
22 0.12
23 0.14
24 0.16
25 0.18
26 0.17
27 0.17
28 0.16
29 0.15
30 0.16
31 0.19
32 0.17
33 0.17
34 0.17
35 0.17
36 0.16
37 0.16
38 0.15
39 0.12
40 0.12
41 0.1
42 0.12
43 0.12
44 0.17
45 0.22
46 0.26
47 0.25
48 0.27
49 0.27
50 0.25
51 0.24
52 0.2
53 0.16
54 0.12
55 0.11
56 0.08
57 0.07
58 0.07
59 0.07
60 0.06
61 0.04
62 0.04
63 0.04
64 0.05
65 0.05
66 0.06
67 0.12
68 0.15
69 0.17
70 0.22
71 0.23
72 0.28
73 0.33
74 0.34
75 0.35
76 0.33
77 0.35
78 0.35
79 0.36
80 0.33
81 0.28
82 0.28
83 0.24
84 0.23
85 0.2
86 0.17
87 0.16
88 0.18
89 0.24
90 0.3
91 0.35
92 0.43
93 0.46
94 0.49