Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316UP04

Protein Details
Accession A0A316UP04   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MRKKEKRRIRGRKPRAIESVSBasic
NLS Segment(s)
PositionSequence
2-15RKKEKRRIRGRKPR
64-69ERRRRR
Subcellular Location(s) mito 18, nucl 8
Family & Domain DBs
Amino Acid Sequences MRKKEKRRIRGRKPRAIESVSSIVDVVFVRRERRCCQERDARRSMSSGSHCSTARRAGSGDGGERRRRRARVGCNSESKSGSQLRQAGTGRAHLVPGGRAEPEQRLQSGQSGERRSGAGLFPHGERERDVRGWLVSRPSSPLAHSLPQSPWHCLFVITATNREQEGADRRSTTAASQRRFGRLASTHRPRGANAMQAWENKESGHFNRASRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.86
3 0.79
4 0.7
5 0.66
6 0.61
7 0.5
8 0.43
9 0.34
10 0.25
11 0.22
12 0.2
13 0.14
14 0.14
15 0.16
16 0.21
17 0.27
18 0.32
19 0.36
20 0.45
21 0.51
22 0.5
23 0.57
24 0.62
25 0.67
26 0.71
27 0.74
28 0.68
29 0.62
30 0.59
31 0.52
32 0.49
33 0.43
34 0.39
35 0.33
36 0.33
37 0.32
38 0.33
39 0.34
40 0.33
41 0.29
42 0.25
43 0.24
44 0.21
45 0.24
46 0.23
47 0.24
48 0.25
49 0.3
50 0.36
51 0.38
52 0.45
53 0.49
54 0.5
55 0.54
56 0.56
57 0.61
58 0.65
59 0.71
60 0.7
61 0.71
62 0.71
63 0.65
64 0.57
65 0.47
66 0.4
67 0.35
68 0.3
69 0.26
70 0.27
71 0.24
72 0.29
73 0.29
74 0.27
75 0.24
76 0.24
77 0.22
78 0.18
79 0.18
80 0.13
81 0.12
82 0.1
83 0.11
84 0.1
85 0.08
86 0.08
87 0.09
88 0.11
89 0.13
90 0.13
91 0.12
92 0.12
93 0.12
94 0.14
95 0.15
96 0.16
97 0.2
98 0.2
99 0.2
100 0.21
101 0.2
102 0.18
103 0.17
104 0.15
105 0.1
106 0.1
107 0.11
108 0.1
109 0.16
110 0.16
111 0.16
112 0.16
113 0.18
114 0.2
115 0.2
116 0.2
117 0.16
118 0.17
119 0.18
120 0.18
121 0.2
122 0.18
123 0.17
124 0.2
125 0.21
126 0.2
127 0.19
128 0.22
129 0.21
130 0.22
131 0.23
132 0.23
133 0.22
134 0.3
135 0.31
136 0.3
137 0.29
138 0.27
139 0.27
140 0.24
141 0.23
142 0.17
143 0.22
144 0.19
145 0.2
146 0.2
147 0.21
148 0.21
149 0.21
150 0.19
151 0.18
152 0.24
153 0.25
154 0.26
155 0.26
156 0.27
157 0.28
158 0.28
159 0.26
160 0.27
161 0.32
162 0.32
163 0.37
164 0.4
165 0.44
166 0.44
167 0.41
168 0.4
169 0.39
170 0.45
171 0.49
172 0.55
173 0.57
174 0.61
175 0.62
176 0.55
177 0.57
178 0.52
179 0.49
180 0.42
181 0.41
182 0.4
183 0.42
184 0.45
185 0.39
186 0.35
187 0.28
188 0.29
189 0.28
190 0.28
191 0.32
192 0.32