Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2TZN4

Protein Details
Accession Q2TZN4    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
321-345VLDKGSQQPRPKKEVPRHKRFELCHBasic
NLS Segment(s)
Subcellular Location(s) plas 7, mito 5, cyto 5, cyto_mito 5, nucl 3, extr 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001525  C5_MeTfrase  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
Pfam View protein in Pfam  
PF00145  DNA_methylase  
Amino Acid Sequences MLIAGFSCVDFSSLNNKRKTLDGSGESGGTFWGILGYAKRYRPRIVVLENVRTAPWGKIAEAWGGIDYFACHAEVDTKAYYLPQTRERGYMLCVDRQRMREHGLEETAMADWVKILSQFKRPASSPAGMFLMDPDDRRLEQIENDMTARIASHTVYNWERYQVRHQNYRMNMGLGHRRPFTRSQEDGSSQMPDFTWQPWLRSMPERVWDTLDANFLRKLVEGYDMNHKERCIELSQGIDREVDTRAYGIVGCITPSGIPYLTIRGGPLCGLESLSLQGLPLDRLILARETQAELQQLAGNAMSSTVVGAAILSALIVGHKVLDKGSQQPRPKKEVPRHKRFELCHDHELVSGSINVDEATDVTISDIQAQAASSARYCIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.4
3 0.42
4 0.43
5 0.48
6 0.51
7 0.48
8 0.47
9 0.43
10 0.43
11 0.43
12 0.42
13 0.37
14 0.31
15 0.24
16 0.15
17 0.11
18 0.06
19 0.05
20 0.05
21 0.06
22 0.08
23 0.14
24 0.2
25 0.26
26 0.33
27 0.37
28 0.41
29 0.44
30 0.49
31 0.51
32 0.5
33 0.54
34 0.54
35 0.57
36 0.55
37 0.51
38 0.45
39 0.38
40 0.35
41 0.26
42 0.24
43 0.18
44 0.17
45 0.19
46 0.2
47 0.21
48 0.2
49 0.19
50 0.15
51 0.13
52 0.13
53 0.1
54 0.08
55 0.07
56 0.07
57 0.07
58 0.06
59 0.06
60 0.1
61 0.1
62 0.14
63 0.13
64 0.13
65 0.13
66 0.14
67 0.16
68 0.19
69 0.22
70 0.27
71 0.31
72 0.33
73 0.35
74 0.36
75 0.35
76 0.31
77 0.35
78 0.3
79 0.31
80 0.32
81 0.34
82 0.38
83 0.39
84 0.41
85 0.36
86 0.38
87 0.35
88 0.34
89 0.33
90 0.29
91 0.26
92 0.23
93 0.2
94 0.16
95 0.13
96 0.1
97 0.07
98 0.05
99 0.05
100 0.05
101 0.07
102 0.1
103 0.12
104 0.19
105 0.26
106 0.28
107 0.31
108 0.32
109 0.35
110 0.37
111 0.37
112 0.3
113 0.27
114 0.26
115 0.22
116 0.21
117 0.16
118 0.14
119 0.12
120 0.12
121 0.12
122 0.13
123 0.13
124 0.14
125 0.15
126 0.13
127 0.13
128 0.18
129 0.17
130 0.16
131 0.16
132 0.15
133 0.13
134 0.12
135 0.11
136 0.07
137 0.07
138 0.06
139 0.07
140 0.07
141 0.12
142 0.13
143 0.16
144 0.16
145 0.19
146 0.2
147 0.22
148 0.31
149 0.35
150 0.39
151 0.44
152 0.46
153 0.49
154 0.49
155 0.52
156 0.43
157 0.35
158 0.31
159 0.26
160 0.32
161 0.28
162 0.29
163 0.26
164 0.26
165 0.28
166 0.32
167 0.36
168 0.35
169 0.34
170 0.34
171 0.36
172 0.37
173 0.36
174 0.31
175 0.26
176 0.19
177 0.17
178 0.14
179 0.11
180 0.11
181 0.09
182 0.16
183 0.15
184 0.16
185 0.18
186 0.2
187 0.21
188 0.24
189 0.26
190 0.21
191 0.26
192 0.27
193 0.26
194 0.26
195 0.24
196 0.22
197 0.2
198 0.22
199 0.16
200 0.16
201 0.15
202 0.13
203 0.13
204 0.12
205 0.11
206 0.08
207 0.11
208 0.1
209 0.12
210 0.22
211 0.25
212 0.27
213 0.28
214 0.27
215 0.24
216 0.24
217 0.25
218 0.17
219 0.16
220 0.15
221 0.18
222 0.2
223 0.19
224 0.19
225 0.17
226 0.15
227 0.14
228 0.13
229 0.1
230 0.08
231 0.08
232 0.07
233 0.07
234 0.07
235 0.06
236 0.07
237 0.06
238 0.06
239 0.06
240 0.06
241 0.06
242 0.06
243 0.07
244 0.06
245 0.07
246 0.07
247 0.1
248 0.11
249 0.11
250 0.11
251 0.1
252 0.11
253 0.1
254 0.1
255 0.08
256 0.07
257 0.07
258 0.07
259 0.07
260 0.08
261 0.08
262 0.07
263 0.06
264 0.07
265 0.07
266 0.07
267 0.07
268 0.07
269 0.06
270 0.07
271 0.08
272 0.09
273 0.09
274 0.1
275 0.11
276 0.13
277 0.14
278 0.16
279 0.15
280 0.14
281 0.15
282 0.15
283 0.14
284 0.12
285 0.11
286 0.09
287 0.08
288 0.08
289 0.06
290 0.05
291 0.04
292 0.04
293 0.04
294 0.03
295 0.03
296 0.03
297 0.03
298 0.03
299 0.03
300 0.02
301 0.02
302 0.03
303 0.03
304 0.03
305 0.04
306 0.06
307 0.06
308 0.07
309 0.11
310 0.13
311 0.23
312 0.32
313 0.39
314 0.48
315 0.57
316 0.64
317 0.69
318 0.75
319 0.77
320 0.78
321 0.81
322 0.83
323 0.85
324 0.86
325 0.85
326 0.85
327 0.79
328 0.79
329 0.78
330 0.75
331 0.7
332 0.65
333 0.57
334 0.5
335 0.49
336 0.38
337 0.29
338 0.22
339 0.16
340 0.13
341 0.12
342 0.11
343 0.08
344 0.08
345 0.07
346 0.07
347 0.07
348 0.07
349 0.08
350 0.1
351 0.1
352 0.12
353 0.12
354 0.11
355 0.12
356 0.12
357 0.11
358 0.12
359 0.13
360 0.11