Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316V2Z3

Protein Details
Accession A0A316V2Z3    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
419-443AQDVRASKDQRRRDRRVQRNGELSDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000286  His_deacetylse  
IPR003084  His_deacetylse_1  
IPR023801  His_deacetylse_dom  
IPR037138  His_deacetylse_dom_sf  
IPR023696  Ureohydrolase_dom_sf  
Gene Ontology GO:0004407  F:histone deacetylase activity  
GO:0016575  P:histone deacetylation  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF00850  Hist_deacetyl  
Amino Acid Sequences MIKAETNPLHWQSDTSSGKQPRRVCYFFDSDIGNYHYGPGHPMKPTRIRMCHSLVMNYGLYKKMEIFRAKPATKREMSQFHTDEYVDFLSRVSPDIVENFVREQAKFNVGDDCPVFDGLFEYCSISAGGSMEGAARLSRDKCDIAINWAGGLHHAKKGEASGFCYINDIVLGILELLRYHPRVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTGELRDTGYGKGRYYSCNFPLRDGITDESYKSVFEPVISKIMEFYQPSAIVLQCGSDSLAGDKLGCFNLSMRGHASCVDYVKSFGLPLLLLGGGGYTMRNVSRAWAYETGLAAGQELSSQVPVNEYYEYFGPDYKLDVRPNNMEDLNTREYLEKIKIQLFENLRHTTFAPSVQGHVAPGVPGDEEMDEIDDLVREGDDAQDVRASKDQRRRDRRVQRNGELSDSEDEGEGGRRDRIDHGNGNGTSPRSRPSIMEPLRRRQEEAAAAAADAGAPASSGSSTPLAAGSAMGATTGSTGGEGRAPGDVEMADS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.35
3 0.41
4 0.47
5 0.53
6 0.6
7 0.63
8 0.62
9 0.67
10 0.66
11 0.61
12 0.6
13 0.6
14 0.55
15 0.51
16 0.45
17 0.36
18 0.37
19 0.35
20 0.29
21 0.22
22 0.22
23 0.2
24 0.18
25 0.22
26 0.23
27 0.25
28 0.29
29 0.34
30 0.4
31 0.48
32 0.57
33 0.62
34 0.64
35 0.64
36 0.65
37 0.67
38 0.65
39 0.58
40 0.52
41 0.44
42 0.4
43 0.37
44 0.32
45 0.28
46 0.24
47 0.23
48 0.2
49 0.22
50 0.23
51 0.3
52 0.34
53 0.35
54 0.42
55 0.52
56 0.54
57 0.56
58 0.59
59 0.6
60 0.57
61 0.59
62 0.57
63 0.56
64 0.57
65 0.6
66 0.55
67 0.48
68 0.47
69 0.43
70 0.34
71 0.29
72 0.26
73 0.17
74 0.15
75 0.14
76 0.13
77 0.13
78 0.14
79 0.12
80 0.1
81 0.11
82 0.13
83 0.16
84 0.15
85 0.16
86 0.16
87 0.2
88 0.21
89 0.2
90 0.22
91 0.22
92 0.26
93 0.26
94 0.25
95 0.27
96 0.25
97 0.28
98 0.24
99 0.23
100 0.19
101 0.19
102 0.18
103 0.11
104 0.12
105 0.09
106 0.1
107 0.08
108 0.08
109 0.07
110 0.08
111 0.08
112 0.07
113 0.07
114 0.07
115 0.07
116 0.06
117 0.06
118 0.05
119 0.05
120 0.06
121 0.05
122 0.05
123 0.09
124 0.1
125 0.12
126 0.15
127 0.15
128 0.16
129 0.21
130 0.21
131 0.22
132 0.24
133 0.23
134 0.2
135 0.2
136 0.18
137 0.16
138 0.19
139 0.15
140 0.15
141 0.15
142 0.15
143 0.15
144 0.18
145 0.21
146 0.18
147 0.2
148 0.21
149 0.21
150 0.21
151 0.22
152 0.2
153 0.15
154 0.14
155 0.1
156 0.06
157 0.05
158 0.05
159 0.03
160 0.03
161 0.03
162 0.03
163 0.05
164 0.07
165 0.08
166 0.09
167 0.09
168 0.11
169 0.13
170 0.14
171 0.15
172 0.14
173 0.16
174 0.16
175 0.18
176 0.17
177 0.15
178 0.13
179 0.11
180 0.1
181 0.07
182 0.07
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.05
189 0.05
190 0.07
191 0.07
192 0.09
193 0.1
194 0.11
195 0.14
196 0.18
197 0.18
198 0.17
199 0.18
200 0.18
201 0.18
202 0.23
203 0.22
204 0.17
205 0.17
206 0.19
207 0.19
208 0.18
209 0.17
210 0.1
211 0.1
212 0.11
213 0.12
214 0.1
215 0.15
216 0.16
217 0.16
218 0.19
219 0.19
220 0.22
221 0.25
222 0.29
223 0.28
224 0.34
225 0.34
226 0.32
227 0.34
228 0.32
229 0.3
230 0.27
231 0.23
232 0.18
233 0.18
234 0.17
235 0.15
236 0.13
237 0.12
238 0.1
239 0.09
240 0.07
241 0.07
242 0.09
243 0.09
244 0.13
245 0.13
246 0.12
247 0.12
248 0.13
249 0.14
250 0.12
251 0.12
252 0.1
253 0.1
254 0.11
255 0.11
256 0.1
257 0.08
258 0.08
259 0.07
260 0.05
261 0.05
262 0.05
263 0.04
264 0.04
265 0.05
266 0.06
267 0.05
268 0.05
269 0.05
270 0.06
271 0.07
272 0.07
273 0.06
274 0.06
275 0.13
276 0.14
277 0.14
278 0.15
279 0.15
280 0.15
281 0.16
282 0.17
283 0.11
284 0.12
285 0.12
286 0.11
287 0.11
288 0.12
289 0.1
290 0.09
291 0.08
292 0.07
293 0.06
294 0.05
295 0.05
296 0.04
297 0.04
298 0.04
299 0.04
300 0.03
301 0.03
302 0.03
303 0.03
304 0.04
305 0.04
306 0.05
307 0.05
308 0.07
309 0.09
310 0.11
311 0.14
312 0.16
313 0.16
314 0.17
315 0.18
316 0.16
317 0.15
318 0.13
319 0.1
320 0.08
321 0.07
322 0.05
323 0.05
324 0.05
325 0.05
326 0.05
327 0.05
328 0.06
329 0.07
330 0.08
331 0.08
332 0.08
333 0.09
334 0.1
335 0.11
336 0.11
337 0.11
338 0.11
339 0.1
340 0.13
341 0.16
342 0.2
343 0.22
344 0.25
345 0.28
346 0.31
347 0.32
348 0.33
349 0.29
350 0.25
351 0.23
352 0.26
353 0.26
354 0.22
355 0.22
356 0.19
357 0.19
358 0.22
359 0.24
360 0.2
361 0.2
362 0.23
363 0.25
364 0.26
365 0.32
366 0.32
367 0.35
368 0.38
369 0.39
370 0.35
371 0.34
372 0.33
373 0.29
374 0.27
375 0.23
376 0.2
377 0.17
378 0.19
379 0.19
380 0.18
381 0.15
382 0.14
383 0.13
384 0.09
385 0.09
386 0.07
387 0.06
388 0.06
389 0.06
390 0.06
391 0.06
392 0.06
393 0.07
394 0.06
395 0.07
396 0.07
397 0.06
398 0.06
399 0.06
400 0.05
401 0.04
402 0.05
403 0.05
404 0.07
405 0.08
406 0.08
407 0.11
408 0.12
409 0.14
410 0.19
411 0.22
412 0.28
413 0.37
414 0.47
415 0.55
416 0.65
417 0.72
418 0.77
419 0.85
420 0.88
421 0.9
422 0.9
423 0.87
424 0.86
425 0.79
426 0.72
427 0.62
428 0.54
429 0.45
430 0.36
431 0.28
432 0.19
433 0.17
434 0.13
435 0.15
436 0.14
437 0.13
438 0.14
439 0.14
440 0.16
441 0.22
442 0.27
443 0.3
444 0.34
445 0.37
446 0.43
447 0.43
448 0.43
449 0.41
450 0.38
451 0.34
452 0.3
453 0.3
454 0.25
455 0.26
456 0.26
457 0.3
458 0.39
459 0.44
460 0.53
461 0.57
462 0.64
463 0.72
464 0.72
465 0.68
466 0.59
467 0.59
468 0.54
469 0.49
470 0.43
471 0.33
472 0.31
473 0.27
474 0.24
475 0.16
476 0.1
477 0.08
478 0.04
479 0.03
480 0.03
481 0.04
482 0.04
483 0.05
484 0.08
485 0.09
486 0.09
487 0.09
488 0.1
489 0.1
490 0.09
491 0.09
492 0.07
493 0.07
494 0.06
495 0.06
496 0.05
497 0.05
498 0.05
499 0.06
500 0.05
501 0.05
502 0.06
503 0.07
504 0.09
505 0.1
506 0.1
507 0.11
508 0.12
509 0.12
510 0.13