Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316UN07

Protein Details
Accession A0A316UN07    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
37-67QVRCRRGKLSHVPWKRKRRGKGRRERGEWTGBasic
NLS Segment(s)
PositionSequence
40-63CRRGKLSHVPWKRKRRGKGRRERG
Subcellular Location(s) mito 15, extr 6, nucl 3, cyto 2
Family & Domain DBs
Amino Acid Sequences MSGPHAHKPCVRGSRAVLSLLDARSCRRPGRTDGRAQVRCRRGKLSHVPWKRKRRGKGRRERGEWTGWTLRLTSGPPSRRPRAAADVAAAAAAATAAGRLSLASSFFTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.48
3 0.46
4 0.37
5 0.31
6 0.33
7 0.29
8 0.26
9 0.19
10 0.2
11 0.25
12 0.28
13 0.29
14 0.3
15 0.33
16 0.39
17 0.48
18 0.52
19 0.55
20 0.59
21 0.66
22 0.68
23 0.68
24 0.69
25 0.68
26 0.66
27 0.6
28 0.58
29 0.5
30 0.52
31 0.58
32 0.59
33 0.61
34 0.65
35 0.72
36 0.76
37 0.84
38 0.85
39 0.83
40 0.82
41 0.83
42 0.84
43 0.85
44 0.86
45 0.87
46 0.87
47 0.84
48 0.8
49 0.73
50 0.67
51 0.57
52 0.52
53 0.45
54 0.35
55 0.31
56 0.26
57 0.23
58 0.19
59 0.19
60 0.19
61 0.23
62 0.27
63 0.35
64 0.42
65 0.47
66 0.49
67 0.51
68 0.5
69 0.5
70 0.5
71 0.43
72 0.37
73 0.33
74 0.29
75 0.26
76 0.2
77 0.12
78 0.07
79 0.05
80 0.03
81 0.02
82 0.02
83 0.02
84 0.02
85 0.03
86 0.03
87 0.04
88 0.05
89 0.07