Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316UQB3

Protein Details
Accession A0A316UQB3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
66-95SASSSSFKPHRRARHRPRNRPLCRGKPNSAHydrophilic
NLS Segment(s)
PositionSequence
73-86KPHRRARHRPRNRP
Subcellular Location(s) mito 17, extr 6, cyto 3
Family & Domain DBs
Amino Acid Sequences MGRASRAATVMSRVAASASLSLLGQWAAPDSGGGVNKAIGSEGDAGASMQTAARTTTGCSASSSRSASSSSFKPHRRARHRPRNRPLCRGKPNSARCHHPLPPPPLSSPALCHRRHLPLRGFVGAGFAVIVRQSRNASTAISPISPMSMALRTASRLSDYDSLRREGWRNGKERGIAARGMGGILCNDAACVRAHEHIASER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.13
4 0.1
5 0.08
6 0.08
7 0.08
8 0.07
9 0.07
10 0.07
11 0.06
12 0.06
13 0.07
14 0.06
15 0.06
16 0.06
17 0.07
18 0.1
19 0.11
20 0.11
21 0.1
22 0.1
23 0.11
24 0.11
25 0.1
26 0.07
27 0.08
28 0.09
29 0.09
30 0.08
31 0.08
32 0.08
33 0.08
34 0.08
35 0.06
36 0.04
37 0.05
38 0.05
39 0.05
40 0.06
41 0.07
42 0.08
43 0.13
44 0.14
45 0.14
46 0.16
47 0.17
48 0.19
49 0.22
50 0.22
51 0.18
52 0.18
53 0.18
54 0.18
55 0.2
56 0.21
57 0.24
58 0.31
59 0.36
60 0.43
61 0.49
62 0.58
63 0.64
64 0.73
65 0.77
66 0.8
67 0.87
68 0.89
69 0.93
70 0.93
71 0.89
72 0.88
73 0.87
74 0.85
75 0.84
76 0.8
77 0.77
78 0.76
79 0.78
80 0.77
81 0.7
82 0.66
83 0.6
84 0.59
85 0.56
86 0.52
87 0.51
88 0.48
89 0.49
90 0.45
91 0.42
92 0.4
93 0.37
94 0.3
95 0.26
96 0.29
97 0.33
98 0.31
99 0.32
100 0.32
101 0.4
102 0.43
103 0.46
104 0.42
105 0.4
106 0.43
107 0.41
108 0.38
109 0.29
110 0.27
111 0.2
112 0.15
113 0.08
114 0.06
115 0.05
116 0.05
117 0.06
118 0.05
119 0.07
120 0.08
121 0.09
122 0.1
123 0.11
124 0.12
125 0.12
126 0.14
127 0.14
128 0.13
129 0.13
130 0.11
131 0.11
132 0.1
133 0.09
134 0.09
135 0.08
136 0.09
137 0.09
138 0.1
139 0.12
140 0.13
141 0.13
142 0.13
143 0.12
144 0.16
145 0.22
146 0.23
147 0.28
148 0.3
149 0.33
150 0.32
151 0.35
152 0.35
153 0.36
154 0.44
155 0.45
156 0.47
157 0.49
158 0.52
159 0.51
160 0.51
161 0.48
162 0.42
163 0.34
164 0.3
165 0.27
166 0.23
167 0.21
168 0.17
169 0.12
170 0.09
171 0.09
172 0.09
173 0.06
174 0.06
175 0.06
176 0.08
177 0.08
178 0.1
179 0.12
180 0.14
181 0.16
182 0.17