Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316UX58

Protein Details
Accession A0A316UX58    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-36AASKSGGKKKKWSKGKVKDKAQNMVVHydrophilic
NLS Segment(s)
PositionSequence
11-29AASKSGGKKKKWSKGKVKD
Subcellular Location(s) mito 23, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPKKAAILAAASKSGGKKKKWSKGKVKDKAQNMVVLDKPTYDKIVKEVPTFKMISQSVLIDRMKINGSLARVAMRHLEREGQIKKVIHHHGQWLYTRSGSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.31
3 0.33
4 0.33
5 0.41
6 0.51
7 0.61
8 0.69
9 0.76
10 0.79
11 0.83
12 0.9
13 0.9
14 0.9
15 0.88
16 0.83
17 0.8
18 0.7
19 0.63
20 0.53
21 0.47
22 0.39
23 0.32
24 0.26
25 0.2
26 0.19
27 0.16
28 0.18
29 0.14
30 0.13
31 0.14
32 0.2
33 0.21
34 0.22
35 0.25
36 0.24
37 0.26
38 0.26
39 0.24
40 0.24
41 0.22
42 0.2
43 0.17
44 0.17
45 0.14
46 0.18
47 0.18
48 0.13
49 0.13
50 0.14
51 0.14
52 0.13
53 0.13
54 0.11
55 0.13
56 0.13
57 0.13
58 0.13
59 0.12
60 0.13
61 0.18
62 0.17
63 0.18
64 0.18
65 0.21
66 0.21
67 0.3
68 0.31
69 0.29
70 0.34
71 0.33
72 0.35
73 0.4
74 0.45
75 0.43
76 0.43
77 0.48
78 0.47
79 0.5
80 0.52
81 0.48
82 0.43