Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316UH91

Protein Details
Accession A0A316UH91   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAQRVTLRRRNPYNTKSNRRRVVKTPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MAQRVTLRRRNPYNTKSNRRRVVKTPGGKLRYLHIKKLPTAPKCGDCHIALPGVKALRPREYATVSKREKSVQRAYGGSRCGQCLRTRIIRAFLVEEAKIVKQVMKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.85
3 0.86
4 0.88
5 0.88
6 0.85
7 0.83
8 0.79
9 0.79
10 0.78
11 0.75
12 0.74
13 0.74
14 0.7
15 0.65
16 0.58
17 0.54
18 0.55
19 0.5
20 0.47
21 0.43
22 0.43
23 0.44
24 0.52
25 0.54
26 0.46
27 0.5
28 0.47
29 0.47
30 0.45
31 0.45
32 0.39
33 0.31
34 0.3
35 0.24
36 0.23
37 0.17
38 0.15
39 0.15
40 0.12
41 0.12
42 0.14
43 0.15
44 0.16
45 0.19
46 0.2
47 0.22
48 0.25
49 0.3
50 0.31
51 0.39
52 0.38
53 0.38
54 0.38
55 0.4
56 0.42
57 0.44
58 0.48
59 0.43
60 0.44
61 0.44
62 0.47
63 0.46
64 0.43
65 0.4
66 0.33
67 0.3
68 0.29
69 0.29
70 0.29
71 0.29
72 0.34
73 0.38
74 0.41
75 0.42
76 0.44
77 0.43
78 0.42
79 0.4
80 0.36
81 0.31
82 0.26
83 0.24
84 0.22
85 0.2
86 0.2
87 0.17