Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316UN11

Protein Details
Accession A0A316UN11    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
171-194SPPPRDYYPPRPRHGRDDRRTSAHBasic
NLS Segment(s)
Subcellular Location(s) extr 10, nucl 6, mito 6, mito_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR010516  SAP18  
IPR042534  SAP18_sf  
Pfam View protein in Pfam  
PF06487  SAP18  
Amino Acid Sequences MSASPFILPVYVTRAATWRPLRDFESATRPLADEFHLYVWPSTTLRSLTHMLHAAAPRLTHPLNPHAFRLIFWDKRRRQYVGDEVAHDIARVSSDDVVNKLSIISRRTLGAAAEHPSSKDGLKTISDIGFQEGDFLECLIPGTTPTTVPLAPLSGPTSIRRYGREDSRAASPPPRDYYPPRPRHGRDDRRTSAHEAATRSRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.3
4 0.35
5 0.36
6 0.37
7 0.4
8 0.43
9 0.44
10 0.46
11 0.41
12 0.44
13 0.4
14 0.37
15 0.34
16 0.32
17 0.28
18 0.26
19 0.23
20 0.17
21 0.16
22 0.16
23 0.16
24 0.16
25 0.15
26 0.15
27 0.15
28 0.13
29 0.13
30 0.13
31 0.14
32 0.14
33 0.18
34 0.19
35 0.18
36 0.21
37 0.22
38 0.21
39 0.23
40 0.23
41 0.21
42 0.19
43 0.18
44 0.16
45 0.18
46 0.18
47 0.16
48 0.18
49 0.24
50 0.29
51 0.31
52 0.31
53 0.3
54 0.3
55 0.28
56 0.33
57 0.32
58 0.32
59 0.37
60 0.46
61 0.48
62 0.56
63 0.6
64 0.55
65 0.51
66 0.51
67 0.53
68 0.52
69 0.48
70 0.41
71 0.38
72 0.36
73 0.33
74 0.26
75 0.18
76 0.09
77 0.08
78 0.07
79 0.06
80 0.06
81 0.07
82 0.07
83 0.08
84 0.09
85 0.08
86 0.08
87 0.07
88 0.08
89 0.1
90 0.11
91 0.11
92 0.11
93 0.11
94 0.12
95 0.12
96 0.11
97 0.1
98 0.11
99 0.12
100 0.12
101 0.12
102 0.12
103 0.12
104 0.13
105 0.11
106 0.1
107 0.08
108 0.09
109 0.09
110 0.11
111 0.12
112 0.12
113 0.13
114 0.12
115 0.13
116 0.12
117 0.11
118 0.11
119 0.09
120 0.09
121 0.08
122 0.08
123 0.06
124 0.05
125 0.06
126 0.05
127 0.05
128 0.05
129 0.07
130 0.07
131 0.07
132 0.09
133 0.1
134 0.1
135 0.11
136 0.11
137 0.1
138 0.1
139 0.11
140 0.12
141 0.12
142 0.13
143 0.16
144 0.19
145 0.23
146 0.25
147 0.27
148 0.31
149 0.35
150 0.42
151 0.45
152 0.44
153 0.42
154 0.46
155 0.47
156 0.44
157 0.44
158 0.4
159 0.4
160 0.43
161 0.44
162 0.44
163 0.47
164 0.56
165 0.61
166 0.66
167 0.67
168 0.71
169 0.72
170 0.77
171 0.81
172 0.81
173 0.8
174 0.81
175 0.81
176 0.78
177 0.78
178 0.74
179 0.69
180 0.64
181 0.58
182 0.53