Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316V0D2

Protein Details
Accession A0A316V0D2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
69-93GHHRLHHLPRLRRRTQKGREDQGLIBasic
NLS Segment(s)
Subcellular Location(s) extr 18, E.R. 4, mito 2, plas 2
Family & Domain DBs
Amino Acid Sequences MGAVYSCLTSIVHAIGGLIMGLFRAIGAALAAVVRAVESESRALAALRPCFGHHADHPLPLFANSRLLGHHRLHHLPRLRRRTQKGREDQGLISAREEGVRRDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.05
5 0.04
6 0.03
7 0.03
8 0.03
9 0.02
10 0.02
11 0.02
12 0.02
13 0.02
14 0.02
15 0.02
16 0.03
17 0.03
18 0.03
19 0.02
20 0.02
21 0.02
22 0.02
23 0.03
24 0.03
25 0.05
26 0.05
27 0.05
28 0.06
29 0.06
30 0.06
31 0.08
32 0.12
33 0.12
34 0.12
35 0.13
36 0.13
37 0.15
38 0.16
39 0.16
40 0.13
41 0.2
42 0.2
43 0.22
44 0.22
45 0.2
46 0.19
47 0.18
48 0.19
49 0.11
50 0.13
51 0.11
52 0.12
53 0.13
54 0.16
55 0.19
56 0.19
57 0.24
58 0.25
59 0.31
60 0.33
61 0.4
62 0.45
63 0.5
64 0.58
65 0.63
66 0.67
67 0.71
68 0.78
69 0.82
70 0.83
71 0.85
72 0.85
73 0.84
74 0.82
75 0.76
76 0.67
77 0.64
78 0.59
79 0.49
80 0.4
81 0.32
82 0.26
83 0.25
84 0.26