Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316V4D8

Protein Details
Accession A0A316V4D8   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-32VNVPKTRRTYCKGKTCKKHTPHKVTQYKTGKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences VNVPKTRRTYCKGKTCKKHTPHKVTQYKTGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTACKYRSHMALKRCKHFELGGDKKQKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.89
4 0.87
5 0.89
6 0.89
7 0.88
8 0.88
9 0.88
10 0.88
11 0.82
12 0.83
13 0.8
14 0.74
15 0.66
16 0.61
17 0.5
18 0.43
19 0.41
20 0.39
21 0.37
22 0.35
23 0.41
24 0.42
25 0.46
26 0.51
27 0.55
28 0.52
29 0.55
30 0.61
31 0.59
32 0.6
33 0.59
34 0.58
35 0.56
36 0.58
37 0.49
38 0.44
39 0.4
40 0.33
41 0.35
42 0.37
43 0.36
44 0.31
45 0.38
46 0.42
47 0.51
48 0.59
49 0.62
50 0.62
51 0.65
52 0.72
53 0.73
54 0.72
55 0.69
56 0.64
57 0.61
58 0.59
59 0.54
60 0.5
61 0.47
62 0.42
63 0.36
64 0.36
65 0.35
66 0.39
67 0.46
68 0.47
69 0.51
70 0.6
71 0.66
72 0.71
73 0.71
74 0.64
75 0.59
76 0.55
77 0.53
78 0.53
79 0.55
80 0.55