Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316ULC2

Protein Details
Accession A0A316ULC2    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
137-164EIDLPTKGFRNCRRRRSRRPSAVMVGRSHydrophilic
NLS Segment(s)
PositionSequence
151-153RRS
Subcellular Location(s) nucl 12, mito 5, cyto 4, plas 3, extr 3
Family & Domain DBs
Amino Acid Sequences MTLLYGMLAFPTRADRLTDTGATLYHSLRADLSATKSKPPRVKPSSEWRLRLQSVPTSCVVRRPLSSAQSLRYTSLTLYAQRLFGLRRIRSLVRLVCVVWHGLELPELPQSRGRDKGFDEACWVHFPLANWIRDHFEIDLPTKGFRNCRRRRSRRPSAVMVGRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.21
4 0.25
5 0.25
6 0.22
7 0.22
8 0.21
9 0.2
10 0.19
11 0.16
12 0.16
13 0.15
14 0.14
15 0.14
16 0.15
17 0.14
18 0.15
19 0.2
20 0.23
21 0.24
22 0.31
23 0.36
24 0.43
25 0.49
26 0.54
27 0.6
28 0.59
29 0.64
30 0.64
31 0.7
32 0.74
33 0.73
34 0.7
35 0.64
36 0.64
37 0.59
38 0.55
39 0.47
40 0.42
41 0.37
42 0.35
43 0.31
44 0.28
45 0.26
46 0.29
47 0.29
48 0.24
49 0.23
50 0.26
51 0.29
52 0.28
53 0.33
54 0.3
55 0.29
56 0.31
57 0.31
58 0.27
59 0.23
60 0.21
61 0.16
62 0.17
63 0.15
64 0.12
65 0.14
66 0.13
67 0.13
68 0.13
69 0.14
70 0.11
71 0.15
72 0.21
73 0.19
74 0.2
75 0.23
76 0.24
77 0.25
78 0.3
79 0.27
80 0.21
81 0.22
82 0.2
83 0.17
84 0.17
85 0.15
86 0.1
87 0.08
88 0.07
89 0.06
90 0.06
91 0.06
92 0.06
93 0.1
94 0.11
95 0.12
96 0.16
97 0.19
98 0.22
99 0.29
100 0.29
101 0.28
102 0.3
103 0.37
104 0.34
105 0.32
106 0.34
107 0.28
108 0.29
109 0.28
110 0.26
111 0.18
112 0.19
113 0.19
114 0.24
115 0.29
116 0.29
117 0.28
118 0.29
119 0.32
120 0.31
121 0.33
122 0.24
123 0.21
124 0.22
125 0.23
126 0.26
127 0.23
128 0.24
129 0.25
130 0.27
131 0.33
132 0.4
133 0.49
134 0.54
135 0.65
136 0.74
137 0.82
138 0.9
139 0.92
140 0.94
141 0.94
142 0.92
143 0.9
144 0.88