Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316URP0

Protein Details
Accession A0A316URP0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
3-24ELDSPKDKLWRKLKKEPLVPIGHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, mito 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR007667  Hypoxia_induced_domain  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF04588  HIG_1_N  
PROSITE View protein in PROSITE  
PS51503  HIG1  
Amino Acid Sequences PAELDSPKDKLWRKLKKEPLVPIGCLLTCGALIVASNHLRKGNRDAFNRSLRWRIYFQGLTVVAAAGGAWYYG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.79
3 0.8
4 0.83
5 0.8
6 0.8
7 0.72
8 0.64
9 0.55
10 0.46
11 0.36
12 0.29
13 0.22
14 0.12
15 0.08
16 0.07
17 0.05
18 0.04
19 0.04
20 0.04
21 0.07
22 0.09
23 0.1
24 0.11
25 0.13
26 0.14
27 0.16
28 0.23
29 0.3
30 0.34
31 0.38
32 0.44
33 0.48
34 0.54
35 0.56
36 0.52
37 0.49
38 0.44
39 0.44
40 0.4
41 0.36
42 0.37
43 0.35
44 0.32
45 0.32
46 0.31
47 0.27
48 0.25
49 0.22
50 0.14
51 0.12
52 0.12
53 0.04