Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316UPW8

Protein Details
Accession A0A316UPW8    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
11-32AITDKRRRGRRIGTTRVLRSRSHydrophilic
93-114VLRCVGRRTRTKTRTRIKNDEAHydrophilic
NLS Segment(s)
PositionSequence
16-21RRRGRR
Subcellular Location(s) nucl 11, mito 7, cyto 5, pero 4
Family & Domain DBs
Amino Acid Sequences MWMGDEGDAIAITDKRRRGRRIGTTRVLRSRSSLMDPGTRRRADETADMGDRATAAALRVFRRAGVWLPLGGEMVGMDDAAAARTSVCKDASVLRCVGRRTRTKTRTRIKNDEALHWMVRSRLVCLLSLRLRPLRLGDPEHDEYPFSLSPPSCLATHDRAASARDGRKRREE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.32
3 0.4
4 0.46
5 0.53
6 0.61
7 0.7
8 0.75
9 0.78
10 0.79
11 0.8
12 0.83
13 0.82
14 0.75
15 0.65
16 0.58
17 0.53
18 0.47
19 0.42
20 0.38
21 0.32
22 0.37
23 0.39
24 0.44
25 0.48
26 0.45
27 0.41
28 0.41
29 0.4
30 0.35
31 0.36
32 0.32
33 0.28
34 0.28
35 0.27
36 0.23
37 0.21
38 0.18
39 0.13
40 0.09
41 0.05
42 0.04
43 0.06
44 0.09
45 0.1
46 0.12
47 0.12
48 0.12
49 0.13
50 0.14
51 0.13
52 0.14
53 0.14
54 0.12
55 0.13
56 0.13
57 0.12
58 0.1
59 0.08
60 0.05
61 0.04
62 0.04
63 0.03
64 0.03
65 0.02
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.04
72 0.05
73 0.06
74 0.07
75 0.06
76 0.07
77 0.14
78 0.17
79 0.19
80 0.19
81 0.2
82 0.23
83 0.24
84 0.29
85 0.29
86 0.34
87 0.4
88 0.5
89 0.57
90 0.63
91 0.72
92 0.77
93 0.81
94 0.82
95 0.83
96 0.77
97 0.76
98 0.68
99 0.63
100 0.57
101 0.49
102 0.41
103 0.32
104 0.28
105 0.2
106 0.22
107 0.18
108 0.15
109 0.16
110 0.16
111 0.17
112 0.18
113 0.24
114 0.24
115 0.26
116 0.29
117 0.28
118 0.28
119 0.28
120 0.3
121 0.29
122 0.29
123 0.31
124 0.3
125 0.35
126 0.38
127 0.38
128 0.35
129 0.3
130 0.26
131 0.27
132 0.24
133 0.17
134 0.17
135 0.16
136 0.18
137 0.2
138 0.22
139 0.17
140 0.19
141 0.24
142 0.25
143 0.29
144 0.29
145 0.29
146 0.28
147 0.3
148 0.33
149 0.36
150 0.38
151 0.43
152 0.49