Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316UWP2

Protein Details
Accession A0A316UWP2    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
38-64RARYVQLKQSRRHRRRPRVPWLSPSPSHydrophilic
NLS Segment(s)
PositionSequence
48-55RRHRRRPR
Subcellular Location(s) nucl 10.5, mito 10, cyto_nucl 7, cyto 2.5, plas 2, extr 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences QPIHQPTKSSPPISGLRAPLEGHSACLLLCSFPIVIVRARYVQLKQSRRHRRRPRVPWLSPSPSSIPQPCQPVAWLLLTPTVFQRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.38
3 0.33
4 0.33
5 0.32
6 0.27
7 0.27
8 0.22
9 0.19
10 0.17
11 0.14
12 0.12
13 0.12
14 0.12
15 0.07
16 0.07
17 0.06
18 0.05
19 0.06
20 0.07
21 0.07
22 0.08
23 0.09
24 0.11
25 0.11
26 0.12
27 0.13
28 0.13
29 0.19
30 0.26
31 0.32
32 0.38
33 0.48
34 0.58
35 0.65
36 0.75
37 0.79
38 0.82
39 0.87
40 0.9
41 0.9
42 0.89
43 0.86
44 0.84
45 0.81
46 0.77
47 0.67
48 0.61
49 0.54
50 0.47
51 0.46
52 0.41
53 0.38
54 0.35
55 0.39
56 0.36
57 0.33
58 0.31
59 0.28
60 0.27
61 0.24
62 0.2
63 0.15
64 0.18
65 0.18
66 0.18