Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316UXA4

Protein Details
Accession A0A316UXA4    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
25-47VQGSGKRPYRIKRTVKGHYTCTCHydrophilic
345-366NSPYERRRSMHCRKVKRWDDGEBasic
449-472DPEVAATQIRKKRKQDDEEFLKAVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 7cyto 7cyto_nucl 7, cysk 6, cyto_mito 6, mito_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR007527  Znf_SWIM  
Gene Ontology GO:0016874  F:ligase activity  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50966  ZF_SWIM  
CDD cd07896  Adenylation_kDNA_ligase_like  
Amino Acid Sequences MDPTTAEVGGVKPSRLLAVGEVVEVQGSGKRPYRIKRTVKGHYTCTCSSFQNAQGASSVAARSCPHLAKILGKEYEAARQRAAGPTDATAPTYAESKRQKKEAAPFDWEEYVAARERVREEQQAGTSSSSGSSGSSSNRSMLGPKGTSLGEGYETDWRGNCTFNGRAIRKDFDPTSAIAIMQAEKWDTKLDPTGWWMSEKLDGVRAYWTGDRLVSRTNLDWKAPHWFIEKLPKGFALDGELWRERDGFEVLSGMCQRADTRAWSTINFFVFDAPDVEAPFEKRMEEARKRVPDGELTPDEALRGRFGGKVATLPFIACEGQAHLDRYVDAIMLQAGEGAMLRRRNSPYERRRSMHCRKVKRWDDGEGVMEGTNRGVGARSHRHESLRVRMASGKAVDIGMGMTESMHLGNDLPEKGVLVKYRCSGLFQDGTPRIPVYEGVCYDRTQPKDPEVAATQIRKKRKQDDEEFLKAVAADLEAAQLVPPWEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.19
4 0.13
5 0.16
6 0.17
7 0.16
8 0.16
9 0.14
10 0.13
11 0.12
12 0.11
13 0.09
14 0.11
15 0.16
16 0.21
17 0.27
18 0.35
19 0.44
20 0.54
21 0.61
22 0.69
23 0.74
24 0.78
25 0.82
26 0.85
27 0.82
28 0.8
29 0.76
30 0.74
31 0.66
32 0.6
33 0.52
34 0.44
35 0.43
36 0.4
37 0.38
38 0.38
39 0.35
40 0.32
41 0.31
42 0.29
43 0.25
44 0.22
45 0.19
46 0.12
47 0.14
48 0.14
49 0.16
50 0.2
51 0.21
52 0.2
53 0.24
54 0.26
55 0.31
56 0.35
57 0.4
58 0.36
59 0.35
60 0.36
61 0.32
62 0.39
63 0.38
64 0.34
65 0.27
66 0.28
67 0.3
68 0.33
69 0.34
70 0.28
71 0.23
72 0.22
73 0.26
74 0.24
75 0.23
76 0.18
77 0.16
78 0.14
79 0.17
80 0.16
81 0.2
82 0.3
83 0.38
84 0.43
85 0.48
86 0.52
87 0.55
88 0.64
89 0.66
90 0.61
91 0.59
92 0.56
93 0.54
94 0.5
95 0.43
96 0.34
97 0.25
98 0.21
99 0.17
100 0.16
101 0.13
102 0.15
103 0.18
104 0.23
105 0.26
106 0.28
107 0.29
108 0.31
109 0.33
110 0.33
111 0.32
112 0.27
113 0.24
114 0.19
115 0.17
116 0.13
117 0.11
118 0.08
119 0.08
120 0.09
121 0.11
122 0.14
123 0.15
124 0.15
125 0.16
126 0.16
127 0.17
128 0.19
129 0.21
130 0.19
131 0.18
132 0.19
133 0.18
134 0.18
135 0.16
136 0.14
137 0.11
138 0.11
139 0.11
140 0.14
141 0.15
142 0.15
143 0.15
144 0.17
145 0.16
146 0.16
147 0.16
148 0.16
149 0.17
150 0.22
151 0.3
152 0.3
153 0.34
154 0.36
155 0.39
156 0.35
157 0.38
158 0.34
159 0.28
160 0.27
161 0.23
162 0.22
163 0.2
164 0.18
165 0.13
166 0.13
167 0.11
168 0.09
169 0.09
170 0.07
171 0.07
172 0.08
173 0.09
174 0.08
175 0.09
176 0.13
177 0.13
178 0.13
179 0.17
180 0.18
181 0.18
182 0.18
183 0.17
184 0.15
185 0.16
186 0.16
187 0.13
188 0.15
189 0.15
190 0.14
191 0.15
192 0.14
193 0.14
194 0.14
195 0.14
196 0.1
197 0.11
198 0.11
199 0.11
200 0.13
201 0.12
202 0.13
203 0.14
204 0.2
205 0.2
206 0.21
207 0.2
208 0.19
209 0.25
210 0.24
211 0.24
212 0.2
213 0.2
214 0.21
215 0.31
216 0.34
217 0.28
218 0.29
219 0.27
220 0.25
221 0.24
222 0.22
223 0.15
224 0.13
225 0.12
226 0.15
227 0.16
228 0.15
229 0.15
230 0.15
231 0.11
232 0.11
233 0.11
234 0.08
235 0.07
236 0.08
237 0.07
238 0.09
239 0.09
240 0.08
241 0.07
242 0.07
243 0.07
244 0.08
245 0.09
246 0.1
247 0.12
248 0.16
249 0.17
250 0.18
251 0.2
252 0.21
253 0.21
254 0.19
255 0.16
256 0.12
257 0.12
258 0.12
259 0.1
260 0.08
261 0.08
262 0.07
263 0.08
264 0.08
265 0.09
266 0.1
267 0.09
268 0.09
269 0.09
270 0.14
271 0.23
272 0.28
273 0.33
274 0.41
275 0.45
276 0.47
277 0.47
278 0.43
279 0.39
280 0.35
281 0.35
282 0.28
283 0.26
284 0.24
285 0.22
286 0.21
287 0.18
288 0.17
289 0.1
290 0.1
291 0.08
292 0.09
293 0.09
294 0.1
295 0.09
296 0.12
297 0.12
298 0.13
299 0.12
300 0.11
301 0.11
302 0.11
303 0.11
304 0.08
305 0.07
306 0.07
307 0.1
308 0.12
309 0.13
310 0.12
311 0.12
312 0.12
313 0.13
314 0.12
315 0.09
316 0.07
317 0.06
318 0.05
319 0.05
320 0.05
321 0.04
322 0.03
323 0.03
324 0.04
325 0.04
326 0.08
327 0.11
328 0.13
329 0.18
330 0.2
331 0.27
332 0.34
333 0.44
334 0.51
335 0.59
336 0.66
337 0.64
338 0.69
339 0.74
340 0.77
341 0.76
342 0.75
343 0.75
344 0.75
345 0.84
346 0.84
347 0.83
348 0.77
349 0.72
350 0.68
351 0.6
352 0.53
353 0.43
354 0.35
355 0.26
356 0.22
357 0.16
358 0.11
359 0.09
360 0.06
361 0.06
362 0.06
363 0.07
364 0.15
365 0.24
366 0.28
367 0.33
368 0.36
369 0.39
370 0.45
371 0.49
372 0.51
373 0.51
374 0.47
375 0.44
376 0.45
377 0.44
378 0.42
379 0.37
380 0.28
381 0.2
382 0.2
383 0.17
384 0.13
385 0.12
386 0.07
387 0.06
388 0.05
389 0.04
390 0.04
391 0.05
392 0.05
393 0.05
394 0.05
395 0.05
396 0.08
397 0.12
398 0.12
399 0.13
400 0.13
401 0.13
402 0.15
403 0.18
404 0.21
405 0.2
406 0.24
407 0.25
408 0.29
409 0.29
410 0.3
411 0.29
412 0.3
413 0.31
414 0.28
415 0.36
416 0.35
417 0.36
418 0.35
419 0.33
420 0.26
421 0.23
422 0.25
423 0.18
424 0.22
425 0.22
426 0.25
427 0.26
428 0.27
429 0.32
430 0.38
431 0.4
432 0.4
433 0.42
434 0.42
435 0.47
436 0.46
437 0.46
438 0.41
439 0.42
440 0.42
441 0.46
442 0.5
443 0.51
444 0.6
445 0.63
446 0.69
447 0.73
448 0.78
449 0.81
450 0.82
451 0.85
452 0.84
453 0.83
454 0.76
455 0.66
456 0.56
457 0.45
458 0.35
459 0.25
460 0.16
461 0.09
462 0.07
463 0.08
464 0.07
465 0.08
466 0.07
467 0.08