FuNGI

A0A316UXA4

Protein Details

Accession

A0A316UXA4

Localization Confidence

Medium

Confidence Score

11.8

NoLS Segment(s)

Position	Sequence	Protein Nature
25-47	VQGSGKRPYRIKRTVKGHYTCTC	Hydrophilic
345-366	NSPYERRRSMHCRKVKRWDDGE	Basic
449-472	DPEVAATQIRKKRKQDDEEFLKAV	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 7, cyto 7, cyto_nucl 7, cysk 6, cyto_mito 6, mito_nucl 6

Family & Domain DBs

InterPro	View protein in InterPro IPR012340 NA-bd_OB-fold IPR007527 Znf_SWIM
Gene Ontology	GO:0016874 F:ligase activity GO:0008270 F:zinc ion binding
PROSITE	View protein in PROSITE PS50966 ZF_SWIM
CDD	cd07896 Adenylation_kDNA_ligase_like

Amino Acid Sequences

MDPTTAEVGGVKPSRLLAVGEVVEVQGSGKRPYRIKRTVKGHYTCTCSSFQNAQGASSVAARSCPHLAKILGKEYEAARQRAAGPTDATAPTYAESKRQKKEAAPFDWEEYVAARERVREEQQAGTSSSSGSSGSSSNRSMLGPKGTSLGEGYETDWRGNCTFNGRAIRKDFDPTSAIAIMQAEKWDTKLDPTGWWMSEKLDGVRAYWTGDRLVSRTNLDWKAPHWFIEKLPKGFALDGELWRERDGFEVLSGMCQRADTRAWSTINFFVFDAPDVEAPFEKRMEEARKRVPDGELTPDEALRGRFGGKVATLPFIACEGQAHLDRYVDAIMLQAGEGAMLRRRNSPYERRRSMHCRKVKRWDDGEGVMEGTNRGVGARSHRHESLRVRMASGKAVDIGMGMTESMHLGNDLPEKGVLVKYRCSGLFQDGTPRIPVYEGVCYDRTQPKDPEVAATQIRKKRKQDDEEFLKAVAADLEAAQLVPPWEV

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.19
2	0.19
3	0.19
4	0.13
5	0.16
6	0.17
7	0.16
8	0.16
9	0.14
10	0.13
11	0.12
12	0.11
13	0.09
14	0.11
15	0.16
16	0.21
17	0.27
18	0.35
19	0.44
20	0.54
21	0.61
22	0.69
23	0.74
24	0.78
25	0.82
26	0.85
27	0.82
28	0.8
29	0.76
30	0.74
31	0.66
32	0.6
33	0.52
34	0.44
35	0.43
36	0.4
37	0.38
38	0.38
39	0.35
40	0.32
41	0.31
42	0.29
43	0.25
44	0.22
45	0.19
46	0.12
47	0.14
48	0.14
49	0.16
50	0.2
51	0.21
52	0.2
53	0.24
54	0.26
55	0.31
56	0.35
57	0.4
58	0.36
59	0.35
60	0.36
61	0.32
62	0.39
63	0.38
64	0.34
65	0.27
66	0.28
67	0.3
68	0.33
69	0.34
70	0.28
71	0.23
72	0.22
73	0.26
74	0.24
75	0.23
76	0.18
77	0.16
78	0.14
79	0.17
80	0.16
81	0.2
82	0.3
83	0.38
84	0.43
85	0.48
86	0.52
87	0.55
88	0.64
89	0.66
90	0.61
91	0.59
92	0.56
93	0.54
94	0.5
95	0.43
96	0.34
97	0.25
98	0.21
99	0.17
100	0.16
101	0.13
102	0.15
103	0.18
104	0.23
105	0.26
106	0.28
107	0.29
108	0.31
109	0.33
110	0.33
111	0.32
112	0.27
113	0.24
114	0.19
115	0.17
116	0.13
117	0.11
118	0.08
119	0.08
120	0.09
121	0.11
122	0.14
123	0.15
124	0.15
125	0.16
126	0.16
127	0.17
128	0.19
129	0.21
130	0.19
131	0.18
132	0.19
133	0.18
134	0.18
135	0.16
136	0.14
137	0.11
138	0.11
139	0.11
140	0.14
141	0.15
142	0.15
143	0.15
144	0.17
145	0.16
146	0.16
147	0.16
148	0.16
149	0.17
150	0.22
151	0.3
152	0.3
153	0.34
154	0.36
155	0.39
156	0.35
157	0.38
158	0.34
159	0.28
160	0.27
161	0.23
162	0.22
163	0.2
164	0.18
165	0.13
166	0.13
167	0.11
168	0.09
169	0.09
170	0.07
171	0.07
172	0.08
173	0.09
174	0.08
175	0.09
176	0.13
177	0.13
178	0.13
179	0.17
180	0.18
181	0.18
182	0.18
183	0.17
184	0.15
185	0.16
186	0.16
187	0.13
188	0.15
189	0.15
190	0.14
191	0.15
192	0.14
193	0.14
194	0.14
195	0.14
196	0.1
197	0.11
198	0.11
199	0.11
200	0.13
201	0.12
202	0.13
203	0.14
204	0.2
205	0.2
206	0.21
207	0.2
208	0.19
209	0.25
210	0.24
211	0.24
212	0.2
213	0.2
214	0.21
215	0.31
216	0.34
217	0.28
218	0.29
219	0.27
220	0.25
221	0.24
222	0.22
223	0.15
224	0.13
225	0.12
226	0.15
227	0.16
228	0.15
229	0.15
230	0.15
231	0.11
232	0.11
233	0.11
234	0.08
235	0.07
236	0.08
237	0.07
238	0.09
239	0.09
240	0.08
241	0.07
242	0.07
243	0.07
244	0.08
245	0.09
246	0.1
247	0.12
248	0.16
249	0.17
250	0.18
251	0.2
252	0.21
253	0.21
254	0.19
255	0.16
256	0.12
257	0.12
258	0.12
259	0.1
260	0.08
261	0.08
262	0.07
263	0.08
264	0.08
265	0.09
266	0.1
267	0.09
268	0.09
269	0.09
270	0.14
271	0.23
272	0.28
273	0.33
274	0.41
275	0.45
276	0.47
277	0.47
278	0.43
279	0.39
280	0.35
281	0.35
282	0.28
283	0.26
284	0.24
285	0.22
286	0.21
287	0.18
288	0.17
289	0.1
290	0.1
291	0.08
292	0.09
293	0.09
294	0.1
295	0.09
296	0.12
297	0.12
298	0.13
299	0.12
300	0.11
301	0.11
302	0.11
303	0.11
304	0.08
305	0.07
306	0.07
307	0.1
308	0.12
309	0.13
310	0.12
311	0.12
312	0.12
313	0.13
314	0.12
315	0.09
316	0.07
317	0.06
318	0.05
319	0.05
320	0.05
321	0.04
322	0.03
323	0.03
324	0.04
325	0.04
326	0.08
327	0.11
328	0.13
329	0.18
330	0.2
331	0.27
332	0.34
333	0.44
334	0.51
335	0.59
336	0.66
337	0.64
338	0.69
339	0.74
340	0.77
341	0.76
342	0.75
343	0.75
344	0.75
345	0.84
346	0.84
347	0.83
348	0.77
349	0.72
350	0.68
351	0.6
352	0.53
353	0.43
354	0.35
355	0.26
356	0.22
357	0.16
358	0.11
359	0.09
360	0.06
361	0.06
362	0.06
363	0.07
364	0.15
365	0.24
366	0.28
367	0.33
368	0.36
369	0.39
370	0.45
371	0.49
372	0.51
373	0.51
374	0.47
375	0.44
376	0.45
377	0.44
378	0.42
379	0.37
380	0.28
381	0.2
382	0.2
383	0.17
384	0.13
385	0.12
386	0.07
387	0.06
388	0.05
389	0.04
390	0.04
391	0.05
392	0.05
393	0.05
394	0.05
395	0.05
396	0.08
397	0.12
398	0.12
399	0.13
400	0.13
401	0.13
402	0.15
403	0.18
404	0.21
405	0.2
406	0.24
407	0.25
408	0.29
409	0.29
410	0.3
411	0.29
412	0.3
413	0.31
414	0.28
415	0.36
416	0.35
417	0.36
418	0.35
419	0.33
420	0.26
421	0.23
422	0.25
423	0.18
424	0.22
425	0.22
426	0.25
427	0.26
428	0.27
429	0.32
430	0.38
431	0.4
432	0.4
433	0.42
434	0.42
435	0.47
436	0.46
437	0.46
438	0.41
439	0.42
440	0.42
441	0.46
442	0.5
443	0.51
444	0.6
445	0.63
446	0.69
447	0.73
448	0.78
449	0.81
450	0.82
451	0.85
452	0.84
453	0.83
454	0.76
455	0.66
456	0.56
457	0.45
458	0.35
459	0.25
460	0.16
461	0.09
462	0.07
463	0.08
464	0.07
465	0.08
466	0.07
467	0.08

A0A316UXA4

3D AlphaFold-predicted Structure Viewer