Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316UYE5

Protein Details
Accession A0A316UYE5    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MVTIVKKRTQKFKRHHSDRYKRVGESHydrophilic
NLS Segment(s)
PositionSequence
6-41KKRTQKFKRHHSDRYKRVGESWRKPRGIDSAVRRRF
Subcellular Location(s) mito_nucl 12, nucl 11.5, mito 11.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVTIVKKRTQKFKRHHSDRYKRVGESWRKPRGIDSAVRRRFRSRTPMCSIGYGSNKKTRHMMPNGLRRFVVSNPRDVDMLLMHNNTFAAEIASNVSSKKRIAILEKAKVLGVKVTNAEARVRAVEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.9
3 0.9
4 0.91
5 0.91
6 0.91
7 0.85
8 0.75
9 0.72
10 0.71
11 0.7
12 0.7
13 0.7
14 0.69
15 0.65
16 0.64
17 0.61
18 0.58
19 0.52
20 0.49
21 0.49
22 0.5
23 0.57
24 0.61
25 0.6
26 0.58
27 0.58
28 0.56
29 0.57
30 0.53
31 0.53
32 0.56
33 0.59
34 0.55
35 0.52
36 0.48
37 0.42
38 0.42
39 0.37
40 0.33
41 0.35
42 0.34
43 0.34
44 0.37
45 0.35
46 0.36
47 0.37
48 0.43
49 0.44
50 0.53
51 0.54
52 0.51
53 0.47
54 0.39
55 0.37
56 0.31
57 0.33
58 0.24
59 0.27
60 0.27
61 0.28
62 0.28
63 0.25
64 0.23
65 0.14
66 0.16
67 0.12
68 0.11
69 0.1
70 0.1
71 0.1
72 0.09
73 0.09
74 0.06
75 0.06
76 0.05
77 0.06
78 0.07
79 0.08
80 0.08
81 0.09
82 0.1
83 0.11
84 0.11
85 0.14
86 0.16
87 0.19
88 0.24
89 0.33
90 0.41
91 0.46
92 0.48
93 0.47
94 0.44
95 0.41
96 0.36
97 0.31
98 0.24
99 0.2
100 0.19
101 0.21
102 0.23
103 0.24
104 0.25
105 0.22
106 0.22