Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316UUI4

Protein Details
Accession A0A316UUI4   
Localization Confidence Low
Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
41-60RYWGRRQLPQRTRRHQQWHYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 5, cyto 3, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000529  Ribosomal_S6  
IPR035980  Ribosomal_S6_sf  
IPR014717  Transl_elong_EF1B/ribosomal_S6  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01250  Ribosomal_S6  
CDD cd15465  bS6_mito  
Amino Acid Sequences MPLYELLCVSAITPSTAPFRELVRSTTRLVVDHGGAVRAMRYWGRRQLPQRTRRHQQWHYEGDYFLMHFDTSPPVLSQLSSRLRADPRVVKWTTLKLGEKLEEITPPGTSAGYTDAQGMAMYGETRPTPPANTVMGGGKTVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.15
3 0.16
4 0.17
5 0.17
6 0.18
7 0.22
8 0.24
9 0.26
10 0.28
11 0.3
12 0.31
13 0.34
14 0.33
15 0.28
16 0.29
17 0.27
18 0.21
19 0.2
20 0.19
21 0.14
22 0.13
23 0.12
24 0.1
25 0.09
26 0.09
27 0.1
28 0.14
29 0.18
30 0.27
31 0.31
32 0.38
33 0.44
34 0.54
35 0.61
36 0.67
37 0.73
38 0.72
39 0.77
40 0.79
41 0.82
42 0.78
43 0.77
44 0.75
45 0.71
46 0.66
47 0.59
48 0.5
49 0.41
50 0.34
51 0.25
52 0.17
53 0.11
54 0.07
55 0.05
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.07
62 0.07
63 0.07
64 0.08
65 0.13
66 0.16
67 0.19
68 0.19
69 0.22
70 0.23
71 0.25
72 0.3
73 0.29
74 0.29
75 0.34
76 0.34
77 0.33
78 0.34
79 0.36
80 0.34
81 0.33
82 0.32
83 0.27
84 0.29
85 0.28
86 0.26
87 0.25
88 0.22
89 0.18
90 0.17
91 0.15
92 0.13
93 0.12
94 0.11
95 0.09
96 0.08
97 0.08
98 0.1
99 0.1
100 0.1
101 0.11
102 0.1
103 0.1
104 0.1
105 0.1
106 0.06
107 0.06
108 0.06
109 0.05
110 0.07
111 0.08
112 0.09
113 0.12
114 0.14
115 0.15
116 0.18
117 0.21
118 0.22
119 0.22
120 0.23
121 0.25
122 0.24