Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316UR76

Protein Details
Accession A0A316UR76   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
36-61LSSSQAAPPPPRRKRAPRTLSSRPGAHydrophilic
NLS Segment(s)
PositionSequence
45-53PPRRKRAPR
Subcellular Location(s) mito 13, nucl 10.5, cyto_nucl 7, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018796  COA8  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0097193  P:intrinsic apoptotic signaling pathway  
Pfam View protein in Pfam  
PF10231  COA8  
Amino Acid Sequences MTSFRSSARLMPSSSSSIAYSMRAYTTASSSSSPSLSSSQAAPPPPRRKRAPRTLSSRPGADLVGPPDPVSNLRPVIYGSAFTAVEAESSSTQQAASTSNHAPQLARQEVHHPYSTSEFTTTPTASSSLPSSISSSRSRALRPPSPYYLSLLSRLESLELTHHLLRSRSDKFSQRFWSDNNRRYTAALDAYRKQHQPEGTGTGGDEAVLLAPFYSAWLDANAKRYRAYNERLWRMTRADLGPAIRYEGMRRWVRCVGWWERIKPW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.25
4 0.23
5 0.23
6 0.21
7 0.19
8 0.16
9 0.15
10 0.14
11 0.15
12 0.14
13 0.16
14 0.16
15 0.16
16 0.16
17 0.17
18 0.19
19 0.18
20 0.17
21 0.17
22 0.17
23 0.17
24 0.17
25 0.17
26 0.2
27 0.24
28 0.28
29 0.33
30 0.41
31 0.51
32 0.57
33 0.63
34 0.68
35 0.75
36 0.8
37 0.84
38 0.84
39 0.83
40 0.84
41 0.86
42 0.85
43 0.78
44 0.69
45 0.59
46 0.5
47 0.41
48 0.34
49 0.26
50 0.2
51 0.19
52 0.17
53 0.16
54 0.15
55 0.15
56 0.16
57 0.15
58 0.15
59 0.14
60 0.14
61 0.15
62 0.15
63 0.17
64 0.15
65 0.14
66 0.11
67 0.12
68 0.12
69 0.11
70 0.11
71 0.08
72 0.08
73 0.07
74 0.08
75 0.06
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.07
82 0.08
83 0.09
84 0.13
85 0.14
86 0.16
87 0.17
88 0.18
89 0.17
90 0.17
91 0.23
92 0.22
93 0.21
94 0.2
95 0.24
96 0.27
97 0.3
98 0.3
99 0.22
100 0.2
101 0.23
102 0.24
103 0.19
104 0.17
105 0.14
106 0.14
107 0.16
108 0.15
109 0.12
110 0.12
111 0.12
112 0.11
113 0.11
114 0.1
115 0.09
116 0.09
117 0.09
118 0.11
119 0.11
120 0.14
121 0.15
122 0.16
123 0.18
124 0.19
125 0.2
126 0.24
127 0.29
128 0.32
129 0.35
130 0.39
131 0.4
132 0.42
133 0.41
134 0.38
135 0.35
136 0.3
137 0.27
138 0.22
139 0.18
140 0.16
141 0.15
142 0.13
143 0.1
144 0.09
145 0.08
146 0.09
147 0.11
148 0.12
149 0.13
150 0.14
151 0.15
152 0.17
153 0.21
154 0.24
155 0.25
156 0.29
157 0.36
158 0.37
159 0.44
160 0.49
161 0.47
162 0.46
163 0.46
164 0.52
165 0.54
166 0.58
167 0.57
168 0.52
169 0.49
170 0.48
171 0.45
172 0.38
173 0.34
174 0.32
175 0.3
176 0.31
177 0.35
178 0.39
179 0.39
180 0.38
181 0.37
182 0.33
183 0.33
184 0.32
185 0.33
186 0.29
187 0.27
188 0.25
189 0.21
190 0.19
191 0.15
192 0.11
193 0.06
194 0.05
195 0.05
196 0.05
197 0.04
198 0.04
199 0.04
200 0.04
201 0.05
202 0.04
203 0.05
204 0.08
205 0.12
206 0.14
207 0.23
208 0.26
209 0.26
210 0.28
211 0.3
212 0.35
213 0.39
214 0.43
215 0.44
216 0.51
217 0.59
218 0.62
219 0.62
220 0.59
221 0.55
222 0.53
223 0.49
224 0.4
225 0.36
226 0.34
227 0.33
228 0.32
229 0.29
230 0.29
231 0.24
232 0.24
233 0.23
234 0.26
235 0.33
236 0.37
237 0.38
238 0.41
239 0.45
240 0.46
241 0.48
242 0.5
243 0.48
244 0.51
245 0.56