Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316V2E0

Protein Details
Accession A0A316V2E0    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
96-126TRESRRETWRKAKGWKPKQGTKNNGRTKRRRBasic
NLS Segment(s)
PositionSequence
97-126RESRRETWRKAKGWKPKQGTKNNGRTKRRR
Subcellular Location(s) nucl 12, mito 11, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSLRARSKVAARNAKRYNDKSDYAVVQAARLAQTSGRLQEKNKHGKTVAEEDADQLEGTQDDEKMAEEPSETDVTGAETKEDGAEPKKISTSGTRESRRETWRKAKGWKPKQGTKNNGRTKRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.74
3 0.76
4 0.76
5 0.72
6 0.71
7 0.66
8 0.64
9 0.56
10 0.54
11 0.46
12 0.38
13 0.37
14 0.27
15 0.21
16 0.2
17 0.17
18 0.13
19 0.12
20 0.1
21 0.08
22 0.11
23 0.13
24 0.16
25 0.2
26 0.21
27 0.23
28 0.31
29 0.4
30 0.48
31 0.48
32 0.47
33 0.43
34 0.44
35 0.46
36 0.44
37 0.38
38 0.28
39 0.27
40 0.24
41 0.23
42 0.21
43 0.16
44 0.09
45 0.07
46 0.05
47 0.06
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.06
54 0.06
55 0.05
56 0.05
57 0.06
58 0.08
59 0.09
60 0.08
61 0.07
62 0.07
63 0.09
64 0.1
65 0.1
66 0.07
67 0.07
68 0.07
69 0.08
70 0.08
71 0.08
72 0.09
73 0.14
74 0.14
75 0.15
76 0.17
77 0.17
78 0.18
79 0.22
80 0.26
81 0.31
82 0.39
83 0.44
84 0.45
85 0.52
86 0.57
87 0.61
88 0.63
89 0.64
90 0.65
91 0.69
92 0.74
93 0.77
94 0.78
95 0.8
96 0.82
97 0.83
98 0.82
99 0.82
100 0.85
101 0.86
102 0.88
103 0.87
104 0.88
105 0.88
106 0.89