Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2UTB5

Protein Details
Accession Q2UTB5   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
136-156EALVRKQKARVEKKKELDAVLHydrophilic
NLS Segment(s)
PositionSequence
145-145R
Subcellular Location(s) nucl 13, mito 9, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018858  DUF2458  
KEGG aor:AO090005000084  -  
Pfam View protein in Pfam  
PF10454  DUF2458  
Amino Acid Sequences MSYNTPDLSSVLATLSALSNQSQPQAQAHPQHQQPYTTNKNTQNVSEDDTDTYEPSETINPLTPSPNIPHPKPQAHPQHPKPPTFHLPDTSTITTWPPALKSIMRTLSTNEDLQRKIRFLIQRQHDHERQWWAGREALVRKQKARVEKKKELDAVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.08
5 0.09
6 0.11
7 0.12
8 0.14
9 0.15
10 0.15
11 0.17
12 0.21
13 0.26
14 0.3
15 0.33
16 0.38
17 0.41
18 0.46
19 0.45
20 0.44
21 0.42
22 0.44
23 0.49
24 0.48
25 0.51
26 0.51
27 0.55
28 0.53
29 0.51
30 0.46
31 0.39
32 0.37
33 0.32
34 0.26
35 0.22
36 0.22
37 0.21
38 0.17
39 0.15
40 0.12
41 0.09
42 0.09
43 0.1
44 0.08
45 0.09
46 0.12
47 0.12
48 0.13
49 0.15
50 0.14
51 0.15
52 0.17
53 0.24
54 0.25
55 0.25
56 0.32
57 0.36
58 0.4
59 0.4
60 0.47
61 0.49
62 0.54
63 0.62
64 0.6
65 0.65
66 0.65
67 0.65
68 0.59
69 0.55
70 0.52
71 0.48
72 0.44
73 0.37
74 0.36
75 0.36
76 0.38
77 0.33
78 0.27
79 0.22
80 0.21
81 0.18
82 0.16
83 0.14
84 0.1
85 0.1
86 0.12
87 0.13
88 0.14
89 0.19
90 0.23
91 0.24
92 0.24
93 0.25
94 0.29
95 0.3
96 0.3
97 0.27
98 0.27
99 0.28
100 0.31
101 0.31
102 0.27
103 0.25
104 0.29
105 0.32
106 0.35
107 0.43
108 0.48
109 0.55
110 0.6
111 0.68
112 0.65
113 0.62
114 0.61
115 0.59
116 0.54
117 0.51
118 0.48
119 0.42
120 0.41
121 0.4
122 0.41
123 0.38
124 0.43
125 0.46
126 0.46
127 0.47
128 0.52
129 0.55
130 0.6
131 0.66
132 0.68
133 0.69
134 0.75
135 0.8
136 0.81