Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316UMZ2

Protein Details
Accession A0A316UMZ2   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
90-114YGRLLKPCIRFRKPKKAPRSRSAHAHydrophilic
NLS Segment(s)
PositionSequence
100-111FRKPKKAPRSRS
191-206KEANERRRSRARALRH
Subcellular Location(s) mito 23, cyto 2
Family & Domain DBs
Amino Acid Sequences MTSSRLPSSRQVGRRKTASLACIRPDVTARASRWVSASYLFKAKPPRLAPPSLTAGMGRQPQWHSSDPLKPLRGESGSRSGIGTGVGEGYGRLLKPCIRFRKPKKAPRSRSAHAHPLSSAPRSLCLCARVYGSSCLPILLSRSHGNSISQCIAQSHVANYNIEVRGYSYEQGERGRTTKVVRAIWSDHEKKEANERRRSRARALRHGAAIHRVMRGWDGSVRLLASKQCGSGRERGEGDNCSFRPVHGGNVGGGGDDVVWAGAMRCGAAEQCRGGVSQVDRAEGEVTALWIMIQSSRACGRTVLLIRRWPAGGDGGRFPAAVSPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.68
3 0.66
4 0.63
5 0.62
6 0.6
7 0.57
8 0.52
9 0.51
10 0.49
11 0.43
12 0.41
13 0.36
14 0.33
15 0.34
16 0.32
17 0.36
18 0.36
19 0.35
20 0.34
21 0.32
22 0.29
23 0.26
24 0.29
25 0.24
26 0.3
27 0.3
28 0.32
29 0.4
30 0.42
31 0.46
32 0.45
33 0.51
34 0.5
35 0.55
36 0.54
37 0.5
38 0.53
39 0.45
40 0.42
41 0.32
42 0.28
43 0.28
44 0.29
45 0.25
46 0.24
47 0.25
48 0.27
49 0.32
50 0.34
51 0.33
52 0.34
53 0.4
54 0.41
55 0.47
56 0.47
57 0.42
58 0.41
59 0.41
60 0.39
61 0.35
62 0.33
63 0.34
64 0.32
65 0.31
66 0.3
67 0.25
68 0.22
69 0.2
70 0.15
71 0.07
72 0.06
73 0.06
74 0.05
75 0.05
76 0.06
77 0.07
78 0.07
79 0.07
80 0.09
81 0.13
82 0.2
83 0.29
84 0.38
85 0.44
86 0.55
87 0.64
88 0.74
89 0.8
90 0.83
91 0.85
92 0.87
93 0.88
94 0.87
95 0.87
96 0.8
97 0.79
98 0.75
99 0.74
100 0.64
101 0.56
102 0.47
103 0.43
104 0.41
105 0.33
106 0.29
107 0.19
108 0.21
109 0.2
110 0.21
111 0.18
112 0.18
113 0.18
114 0.17
115 0.18
116 0.16
117 0.17
118 0.18
119 0.17
120 0.16
121 0.14
122 0.13
123 0.12
124 0.11
125 0.11
126 0.09
127 0.11
128 0.11
129 0.13
130 0.14
131 0.15
132 0.15
133 0.14
134 0.17
135 0.15
136 0.14
137 0.13
138 0.12
139 0.13
140 0.13
141 0.13
142 0.11
143 0.13
144 0.13
145 0.13
146 0.13
147 0.16
148 0.15
149 0.14
150 0.13
151 0.1
152 0.11
153 0.12
154 0.12
155 0.09
156 0.1
157 0.12
158 0.13
159 0.14
160 0.13
161 0.13
162 0.14
163 0.15
164 0.16
165 0.18
166 0.22
167 0.23
168 0.23
169 0.25
170 0.26
171 0.29
172 0.36
173 0.36
174 0.31
175 0.33
176 0.33
177 0.31
178 0.4
179 0.43
180 0.44
181 0.5
182 0.54
183 0.58
184 0.66
185 0.7
186 0.68
187 0.67
188 0.67
189 0.67
190 0.69
191 0.63
192 0.57
193 0.55
194 0.47
195 0.44
196 0.38
197 0.29
198 0.24
199 0.2
200 0.18
201 0.17
202 0.16
203 0.13
204 0.12
205 0.12
206 0.12
207 0.12
208 0.12
209 0.11
210 0.12
211 0.12
212 0.14
213 0.13
214 0.15
215 0.16
216 0.19
217 0.22
218 0.28
219 0.29
220 0.31
221 0.31
222 0.31
223 0.32
224 0.33
225 0.33
226 0.33
227 0.3
228 0.29
229 0.27
230 0.24
231 0.28
232 0.25
233 0.26
234 0.21
235 0.22
236 0.18
237 0.2
238 0.2
239 0.13
240 0.13
241 0.09
242 0.06
243 0.05
244 0.05
245 0.03
246 0.03
247 0.03
248 0.03
249 0.04
250 0.04
251 0.04
252 0.04
253 0.05
254 0.07
255 0.1
256 0.12
257 0.12
258 0.13
259 0.14
260 0.14
261 0.14
262 0.18
263 0.17
264 0.22
265 0.22
266 0.22
267 0.22
268 0.23
269 0.23
270 0.18
271 0.17
272 0.1
273 0.1
274 0.08
275 0.08
276 0.07
277 0.06
278 0.06
279 0.06
280 0.09
281 0.09
282 0.13
283 0.17
284 0.18
285 0.19
286 0.19
287 0.19
288 0.25
289 0.32
290 0.36
291 0.38
292 0.43
293 0.45
294 0.47
295 0.47
296 0.38
297 0.33
298 0.33
299 0.31
300 0.29
301 0.3
302 0.3
303 0.3
304 0.3
305 0.28