Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316UZ64

Protein Details
Accession A0A316UZ64    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
17-41LPSNTIQQPQPRRPRKVGAFRSPLAHydrophilic
NLS Segment(s)
PositionSequence
133-143RREAEKRQREK
156-158GKR
Subcellular Location(s) mito 14, nucl 5, extr 5, cyto 2
Family & Domain DBs
Amino Acid Sequences MVTSRSTSPAMSILPALPSNTIQQPQPRRPRKVGAFRSPLASSDGNSNAAGRSTGEGGDSSARPTAAGSSSSSSSPRYSPYPTPVALFQLLDTSSTKESEHLLAPYNTRYPGAPGTALFKAREAAAKQALAARREAEKRQREKDELVRLGVGEKMGKRARDSVKRSESPYPAGNASASTSAVGTPATRKSARGGKAVAGENRRGHGSRGSSVARSVNGSVGPDSIHGSGSGDLLTVPGATGSTSSNGRVRRPISRGASPIPLTAHASNGSAVEPMNGSSSSTTRRSGKSPEQQTPVKTNGSGNSAGASGGAGGGVGGVAAPSGPLAAALTAQPFQSSPLARDSVSSFPSTPDGGGNLAVGGRGAENLSPPDGASGRRAGSRSPRLAARELAVVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.18
4 0.17
5 0.17
6 0.2
7 0.24
8 0.25
9 0.26
10 0.34
11 0.43
12 0.52
13 0.62
14 0.68
15 0.71
16 0.76
17 0.82
18 0.84
19 0.85
20 0.85
21 0.84
22 0.82
23 0.75
24 0.73
25 0.63
26 0.54
27 0.48
28 0.38
29 0.29
30 0.27
31 0.27
32 0.24
33 0.23
34 0.23
35 0.18
36 0.18
37 0.17
38 0.12
39 0.12
40 0.11
41 0.11
42 0.11
43 0.11
44 0.12
45 0.15
46 0.15
47 0.14
48 0.14
49 0.14
50 0.13
51 0.13
52 0.15
53 0.12
54 0.13
55 0.14
56 0.15
57 0.17
58 0.18
59 0.19
60 0.19
61 0.19
62 0.19
63 0.21
64 0.22
65 0.26
66 0.29
67 0.34
68 0.37
69 0.36
70 0.36
71 0.34
72 0.34
73 0.29
74 0.25
75 0.19
76 0.16
77 0.15
78 0.15
79 0.15
80 0.14
81 0.13
82 0.14
83 0.14
84 0.13
85 0.15
86 0.16
87 0.17
88 0.15
89 0.19
90 0.19
91 0.21
92 0.23
93 0.23
94 0.21
95 0.2
96 0.19
97 0.18
98 0.18
99 0.18
100 0.16
101 0.14
102 0.18
103 0.2
104 0.22
105 0.19
106 0.17
107 0.16
108 0.16
109 0.19
110 0.16
111 0.18
112 0.19
113 0.19
114 0.19
115 0.23
116 0.25
117 0.22
118 0.22
119 0.19
120 0.22
121 0.26
122 0.32
123 0.37
124 0.43
125 0.5
126 0.57
127 0.61
128 0.6
129 0.62
130 0.63
131 0.63
132 0.55
133 0.48
134 0.41
135 0.35
136 0.32
137 0.27
138 0.19
139 0.12
140 0.1
141 0.16
142 0.19
143 0.2
144 0.2
145 0.28
146 0.35
147 0.42
148 0.47
149 0.5
150 0.56
151 0.58
152 0.6
153 0.59
154 0.53
155 0.47
156 0.44
157 0.36
158 0.28
159 0.25
160 0.21
161 0.15
162 0.14
163 0.11
164 0.09
165 0.07
166 0.06
167 0.06
168 0.06
169 0.06
170 0.05
171 0.07
172 0.08
173 0.12
174 0.12
175 0.13
176 0.17
177 0.24
178 0.26
179 0.27
180 0.27
181 0.25
182 0.3
183 0.32
184 0.33
185 0.28
186 0.29
187 0.27
188 0.26
189 0.26
190 0.21
191 0.2
192 0.19
193 0.19
194 0.17
195 0.2
196 0.21
197 0.19
198 0.2
199 0.2
200 0.17
201 0.16
202 0.14
203 0.11
204 0.1
205 0.11
206 0.09
207 0.08
208 0.08
209 0.07
210 0.09
211 0.08
212 0.08
213 0.07
214 0.08
215 0.08
216 0.08
217 0.07
218 0.05
219 0.05
220 0.05
221 0.05
222 0.04
223 0.03
224 0.03
225 0.03
226 0.03
227 0.04
228 0.04
229 0.06
230 0.07
231 0.09
232 0.13
233 0.16
234 0.18
235 0.23
236 0.25
237 0.3
238 0.33
239 0.4
240 0.41
241 0.43
242 0.45
243 0.42
244 0.44
245 0.38
246 0.36
247 0.29
248 0.25
249 0.24
250 0.21
251 0.19
252 0.15
253 0.15
254 0.14
255 0.13
256 0.12
257 0.09
258 0.08
259 0.07
260 0.07
261 0.07
262 0.08
263 0.07
264 0.08
265 0.08
266 0.1
267 0.14
268 0.17
269 0.2
270 0.23
271 0.26
272 0.29
273 0.36
274 0.44
275 0.49
276 0.55
277 0.58
278 0.6
279 0.62
280 0.63
281 0.6
282 0.54
283 0.47
284 0.4
285 0.35
286 0.31
287 0.31
288 0.28
289 0.22
290 0.19
291 0.17
292 0.16
293 0.13
294 0.1
295 0.06
296 0.05
297 0.04
298 0.03
299 0.02
300 0.02
301 0.02
302 0.02
303 0.02
304 0.02
305 0.02
306 0.02
307 0.02
308 0.02
309 0.02
310 0.02
311 0.03
312 0.03
313 0.03
314 0.04
315 0.05
316 0.07
317 0.08
318 0.08
319 0.09
320 0.09
321 0.11
322 0.16
323 0.16
324 0.17
325 0.21
326 0.23
327 0.22
328 0.24
329 0.25
330 0.25
331 0.26
332 0.26
333 0.22
334 0.22
335 0.24
336 0.23
337 0.2
338 0.17
339 0.16
340 0.14
341 0.14
342 0.12
343 0.1
344 0.09
345 0.08
346 0.07
347 0.06
348 0.05
349 0.06
350 0.07
351 0.07
352 0.09
353 0.11
354 0.13
355 0.12
356 0.12
357 0.15
358 0.16
359 0.17
360 0.18
361 0.21
362 0.22
363 0.26
364 0.27
365 0.29
366 0.38
367 0.47
368 0.49
369 0.49
370 0.53
371 0.54
372 0.57
373 0.54
374 0.46