Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316UI22

Protein Details
Accession A0A316UI22    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
87-117QHKNSGRGGRQSNKKGNKKSSQGSRRNCEEQHydrophilic
NLS Segment(s)
PositionSequence
79-106KAPSKSNGQHKNSGRGGRQSNKKGNKKS
Subcellular Location(s) extr 23, golg 2, nucl 1.5, cyto_nucl 1.5
Family & Domain DBs
Amino Acid Sequences MRFLVVLAVIMTLATTALSLVLPLESDMNPLDIDNYPADIAPVLPRDSSDPNGPHESMDPTTGDDPTGFPGDGQTSEKKAPSKSNGQHKNSGRGGRQSNKKGNKKSSQGSRRNCEEQLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.03
6 0.04
7 0.04
8 0.04
9 0.04
10 0.05
11 0.07
12 0.06
13 0.08
14 0.08
15 0.09
16 0.09
17 0.08
18 0.1
19 0.08
20 0.1
21 0.09
22 0.1
23 0.09
24 0.09
25 0.09
26 0.07
27 0.07
28 0.07
29 0.09
30 0.09
31 0.09
32 0.09
33 0.12
34 0.15
35 0.16
36 0.2
37 0.19
38 0.22
39 0.25
40 0.25
41 0.22
42 0.21
43 0.21
44 0.17
45 0.16
46 0.12
47 0.11
48 0.11
49 0.11
50 0.1
51 0.08
52 0.07
53 0.08
54 0.09
55 0.08
56 0.07
57 0.08
58 0.09
59 0.1
60 0.12
61 0.12
62 0.14
63 0.16
64 0.19
65 0.21
66 0.23
67 0.28
68 0.31
69 0.39
70 0.43
71 0.53
72 0.6
73 0.62
74 0.68
75 0.66
76 0.7
77 0.66
78 0.65
79 0.58
80 0.56
81 0.59
82 0.59
83 0.66
84 0.66
85 0.7
86 0.74
87 0.8
88 0.82
89 0.84
90 0.84
91 0.83
92 0.83
93 0.84
94 0.84
95 0.84
96 0.85
97 0.83
98 0.82
99 0.79