FuNGI

A0A316UJJ0

Protein Details

Accession

A0A316UJJ0

Localization Confidence

Medium

Confidence Score

10.8

NoLS Segment(s)

Position	Sequence	Protein Nature
3-28	NSNPPPSRPARPKVVQPKPTNKQLAS	Hydrophilic

NLS Segment(s)

Position	Sequence
287-300	WRVARRRREEGKKR

Subcellular Location(s)

mito 14, nucl 9.5, cyto_nucl 7, cyto 3.5

Family & Domain DBs

InterPro	View protein in InterPro IPR047260 ERCC1-like_central_dom IPR004579 ERCC1/RAD10/SWI10 IPR011335 Restrct_endonuc-II-like IPR010994 RuvA_2-like
Gene Ontology	GO:0005634 C:nucleus GO:0003684 F:damaged DNA binding GO:0006310 P:DNA recombination GO:0006302 P:double-strand break repair
Pfam	View protein in Pfam PF03834 Rad10
CDD	cd22325 ERCC1_C-like

Amino Acid Sequences

MNNSNPPPSRPARPKVVQPKPTNKQLASPSAAPPAQPVAGPSTSSSSTLPAQPQPQPGGSAPRPAPIARSTGPKILAPSGSSSLLVQNTQRGNPLLRTLRSIPWEFADIPADYQLSPSRGALFLSLKYHRLHPEYVHDRIAKLRGIGRYEHRLLLIQVDIPLPQTALKELTKTSLVNGFTLLLSWSPQEVARYLEQYKIYETKGPELIRERRGEDHLGAMTSCLTSVPRINRTDVRNLVAKFGSLRRLSRASAGDLADMSGFGEIKVRLLTEAFRTPFRVGGGGGAWRVARRRREEGKKRSGVGDGDEMDDIEEIEDDDDDEDGAEMMRGQGTHVAGVAGALQTAGADADGEAGRDGSGASKRRRIELRVDEEEERDAGNGVVNPKPPAQGDVRGEAEDHLPLDNLNDADDLAALAAEEGNLGSGSGSDPIERQGHGAAQDDDGNDDEFGSDLNLDELTAEEREELRRAMRMSMA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.73
2	0.76
3	0.82
4	0.81
5	0.82
6	0.85
7	0.83
8	0.87
9	0.85
10	0.75
11	0.72
12	0.69
13	0.67
14	0.61
15	0.56
16	0.49
17	0.48
18	0.47
19	0.39
20	0.34
21	0.3
22	0.25
23	0.22
24	0.21
25	0.19
26	0.19
27	0.2
28	0.19
29	0.21
30	0.21
31	0.22
32	0.21
33	0.19
34	0.21
35	0.24
36	0.27
37	0.28
38	0.32
39	0.36
40	0.41
41	0.42
42	0.4
43	0.39
44	0.37
45	0.41
46	0.37
47	0.4
48	0.35
49	0.35
50	0.37
51	0.33
52	0.35
53	0.28
54	0.32
55	0.27
56	0.33
57	0.33
58	0.36
59	0.37
60	0.35
61	0.35
62	0.33
63	0.32
64	0.25
65	0.26
66	0.24
67	0.23
68	0.21
69	0.19
70	0.19
71	0.19
72	0.19
73	0.16
74	0.2
75	0.22
76	0.23
77	0.25
78	0.24
79	0.25
80	0.26
81	0.33
82	0.33
83	0.31
84	0.36
85	0.36
86	0.39
87	0.42
88	0.42
89	0.35
90	0.3
91	0.33
92	0.28
93	0.26
94	0.24
95	0.18
96	0.17
97	0.17
98	0.16
99	0.12
100	0.13
101	0.14
102	0.13
103	0.14
104	0.14
105	0.14
106	0.14
107	0.14
108	0.15
109	0.15
110	0.15
111	0.19
112	0.21
113	0.22
114	0.23
115	0.28
116	0.3
117	0.31
118	0.32
119	0.29
120	0.37
121	0.4
122	0.42
123	0.43
124	0.38
125	0.36
126	0.36
127	0.37
128	0.28
129	0.24
130	0.26
131	0.24
132	0.26
133	0.29
134	0.3
135	0.35
136	0.35
137	0.34
138	0.3
139	0.28
140	0.26
141	0.24
142	0.19
143	0.13
144	0.11
145	0.11
146	0.1
147	0.1
148	0.1
149	0.08
150	0.08
151	0.08
152	0.08
153	0.11
154	0.12
155	0.12
156	0.12
157	0.14
158	0.15
159	0.15
160	0.15
161	0.17
162	0.17
163	0.16
164	0.16
165	0.14
166	0.12
167	0.12
168	0.11
169	0.06
170	0.06
171	0.06
172	0.06
173	0.06
174	0.07
175	0.07
176	0.08
177	0.1
178	0.11
179	0.14
180	0.15
181	0.18
182	0.18
183	0.18
184	0.2
185	0.2
186	0.2
187	0.21
188	0.21
189	0.2
190	0.24
191	0.24
192	0.24
193	0.29
194	0.34
195	0.35
196	0.36
197	0.35
198	0.32
199	0.35
200	0.34
201	0.27
202	0.23
203	0.19
204	0.17
205	0.14
206	0.12
207	0.09
208	0.07
209	0.07
210	0.04
211	0.04
212	0.05
213	0.09
214	0.13
215	0.18
216	0.2
217	0.23
218	0.28
219	0.3
220	0.36
221	0.34
222	0.33
223	0.32
224	0.31
225	0.31
226	0.25
227	0.23
228	0.18
229	0.18
230	0.21
231	0.18
232	0.18
233	0.2
234	0.22
235	0.22
236	0.25
237	0.24
238	0.2
239	0.21
240	0.21
241	0.17
242	0.15
243	0.15
244	0.11
245	0.09
246	0.07
247	0.04
248	0.04
249	0.03
250	0.06
251	0.05
252	0.06
253	0.06
254	0.06
255	0.06
256	0.07
257	0.08
258	0.09
259	0.14
260	0.15
261	0.16
262	0.18
263	0.18
264	0.19
265	0.19
266	0.16
267	0.11
268	0.11
269	0.11
270	0.1
271	0.09
272	0.09
273	0.09
274	0.09
275	0.14
276	0.18
277	0.24
278	0.29
279	0.37
280	0.46
281	0.57
282	0.67
283	0.73
284	0.78
285	0.77
286	0.73
287	0.66
288	0.6
289	0.5
290	0.41
291	0.35
292	0.25
293	0.21
294	0.19
295	0.17
296	0.14
297	0.12
298	0.1
299	0.06
300	0.05
301	0.04
302	0.04
303	0.04
304	0.04
305	0.04
306	0.04
307	0.04
308	0.04
309	0.04
310	0.04
311	0.04
312	0.03
313	0.03
314	0.04
315	0.04
316	0.04
317	0.04
318	0.07
319	0.08
320	0.08
321	0.08
322	0.08
323	0.07
324	0.07
325	0.07
326	0.04
327	0.04
328	0.04
329	0.03
330	0.03
331	0.03
332	0.03
333	0.02
334	0.02
335	0.03
336	0.05
337	0.05
338	0.06
339	0.06
340	0.06
341	0.06
342	0.06
343	0.06
344	0.07
345	0.13
346	0.2
347	0.25
348	0.31
349	0.33
350	0.4
351	0.45
352	0.46
353	0.5
354	0.53
355	0.57
356	0.57
357	0.6
358	0.55
359	0.51
360	0.48
361	0.38
362	0.29
363	0.2
364	0.14
365	0.1
366	0.1
367	0.11
368	0.13
369	0.15
370	0.17
371	0.19
372	0.2
373	0.22
374	0.21
375	0.22
376	0.24
377	0.28
378	0.3
379	0.33
380	0.33
381	0.31
382	0.31
383	0.29
384	0.26
385	0.19
386	0.16
387	0.12
388	0.1
389	0.09
390	0.1
391	0.11
392	0.1
393	0.1
394	0.09
395	0.09
396	0.09
397	0.09
398	0.08
399	0.05
400	0.05
401	0.04
402	0.04
403	0.04
404	0.03
405	0.03
406	0.03
407	0.04
408	0.04
409	0.04
410	0.04
411	0.04
412	0.05
413	0.07
414	0.08
415	0.08
416	0.09
417	0.13
418	0.15
419	0.15
420	0.16
421	0.16
422	0.18
423	0.19
424	0.23
425	0.2
426	0.2
427	0.22
428	0.21
429	0.2
430	0.19
431	0.18
432	0.14
433	0.13
434	0.11
435	0.09
436	0.08
437	0.08
438	0.07
439	0.06
440	0.06
441	0.06
442	0.06
443	0.06
444	0.07
445	0.08
446	0.09
447	0.09
448	0.1
449	0.12
450	0.15
451	0.18
452	0.19
453	0.19
454	0.24
455	0.25

A0A316UJJ0

3D AlphaFold-predicted Structure Viewer