Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316UN20

Protein Details
Accession A0A316UN20    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
16-40LWKNPWRLSTPRKSRVRQRLRDVDDHydrophilic
78-97KTSRGFRKSVHKVPKWTRLSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto_mito 13.333, mito_nucl 12.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGIFKPSPVAMGGLLWKNPWRLSTPRKSRVRQRLRDVDDVVATIAASGVECKPLTRALYMPTEAEMPPKDKYTTFSKTSRGFRKSVHKVPKWTRLSLRTNPAGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.17
4 0.19
5 0.2
6 0.21
7 0.22
8 0.22
9 0.28
10 0.37
11 0.47
12 0.54
13 0.62
14 0.7
15 0.75
16 0.81
17 0.84
18 0.85
19 0.83
20 0.83
21 0.83
22 0.79
23 0.78
24 0.69
25 0.6
26 0.49
27 0.4
28 0.3
29 0.19
30 0.13
31 0.07
32 0.05
33 0.03
34 0.03
35 0.04
36 0.04
37 0.05
38 0.05
39 0.05
40 0.07
41 0.09
42 0.1
43 0.1
44 0.11
45 0.12
46 0.15
47 0.15
48 0.15
49 0.13
50 0.14
51 0.13
52 0.15
53 0.14
54 0.14
55 0.15
56 0.17
57 0.18
58 0.16
59 0.2
60 0.25
61 0.29
62 0.32
63 0.34
64 0.39
65 0.45
66 0.53
67 0.59
68 0.56
69 0.53
70 0.54
71 0.61
72 0.64
73 0.67
74 0.68
75 0.66
76 0.72
77 0.79
78 0.83
79 0.77
80 0.75
81 0.73
82 0.71
83 0.73
84 0.71
85 0.71