Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316UKH0

Protein Details
Accession A0A316UKH0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
67-86AEACHCKHSCKKPPLARAVSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, extr 9
Family & Domain DBs
Amino Acid Sequences MHAIRHFIAYWPRLLLLALLVLQTLLSTPRLGSTGLGMVQALGSCCQTQEGTYFSRVGGCPKGTDYAEACHCKHSCKKPPLARAVSEGRGLAVVVEKDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.17
3 0.1
4 0.1
5 0.08
6 0.07
7 0.06
8 0.05
9 0.05
10 0.05
11 0.05
12 0.05
13 0.05
14 0.05
15 0.06
16 0.07
17 0.08
18 0.08
19 0.08
20 0.08
21 0.09
22 0.09
23 0.09
24 0.08
25 0.07
26 0.06
27 0.06
28 0.06
29 0.05
30 0.05
31 0.05
32 0.05
33 0.06
34 0.06
35 0.06
36 0.07
37 0.08
38 0.09
39 0.11
40 0.11
41 0.1
42 0.13
43 0.13
44 0.14
45 0.15
46 0.14
47 0.14
48 0.15
49 0.18
50 0.16
51 0.18
52 0.16
53 0.17
54 0.23
55 0.26
56 0.26
57 0.29
58 0.29
59 0.33
60 0.4
61 0.47
62 0.51
63 0.56
64 0.66
65 0.68
66 0.77
67 0.82
68 0.78
69 0.7
70 0.66
71 0.64
72 0.56
73 0.49
74 0.4
75 0.3
76 0.25
77 0.22
78 0.16
79 0.14