Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316V6L0

Protein Details
Accession A0A316V6L0    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
325-352LEALRASRKQKQEERKKREVEKMMRDLRBasic
NLS Segment(s)
PositionSequence
330-364ASRKQKQEERKKREVEKMMRDLRVKPSGKAAPKAA
Subcellular Location(s) mito 11, nucl 10, cyto_nucl 8.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004130  Gpn  
IPR030230  Gpn1/Npa3/XAB1  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
Pfam View protein in Pfam  
PF03029  ATP_bind_1  
CDD cd17870  GPN1  
Amino Acid Sequences MASASSSTTPAAGSSRSNQDAELLPPIPKSNAILVIGMAGSGKSTLAGALSRHLEAEAAKRNPSAASSDPSASSSDASYLVNLDPAVSTLNYEPNVDIRDTVDYKRVMDEYNLGPNGGILTALNLFTTKFDQVMGILEGRSNEVDNIILDTPGQIEIFTWSASGTIITDSLASALPTCIAYVVDTPRTTAPATFMSNMLYACSIMYKTKLPFIIVFNKEDEQDAGFAREWMEDFEAFQEALNKGNATDQVDVGRGNPRARGAAGQEGEASYMNSLVNSMALLLEEFYNSIRAVSVSSLTGSGMPSFLSAVQEARQEYVDEYRPELEALRASRKQKQEERKKREVEKMMRDLRVKPSGKAAPKAATGARGGGGEVDDDDEEDPRITRMADRMRVPGYEGDGLIMEPDDDDVLLQTHGAAQTQAGQVPRRGGAQRGEGEDLASVGQRRREEQLARARLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.28
3 0.31
4 0.32
5 0.3
6 0.32
7 0.32
8 0.31
9 0.31
10 0.25
11 0.22
12 0.23
13 0.25
14 0.23
15 0.22
16 0.22
17 0.2
18 0.23
19 0.23
20 0.21
21 0.19
22 0.19
23 0.18
24 0.15
25 0.11
26 0.07
27 0.06
28 0.05
29 0.05
30 0.04
31 0.05
32 0.05
33 0.06
34 0.08
35 0.08
36 0.12
37 0.15
38 0.15
39 0.15
40 0.15
41 0.15
42 0.15
43 0.21
44 0.26
45 0.27
46 0.28
47 0.28
48 0.29
49 0.29
50 0.29
51 0.26
52 0.21
53 0.23
54 0.24
55 0.25
56 0.25
57 0.26
58 0.26
59 0.21
60 0.18
61 0.14
62 0.12
63 0.12
64 0.11
65 0.11
66 0.11
67 0.1
68 0.11
69 0.1
70 0.09
71 0.08
72 0.08
73 0.09
74 0.08
75 0.09
76 0.09
77 0.14
78 0.14
79 0.15
80 0.15
81 0.16
82 0.18
83 0.17
84 0.16
85 0.13
86 0.18
87 0.2
88 0.21
89 0.24
90 0.23
91 0.23
92 0.25
93 0.25
94 0.21
95 0.2
96 0.23
97 0.2
98 0.26
99 0.25
100 0.23
101 0.21
102 0.2
103 0.19
104 0.14
105 0.12
106 0.04
107 0.05
108 0.06
109 0.06
110 0.06
111 0.06
112 0.06
113 0.07
114 0.1
115 0.09
116 0.08
117 0.09
118 0.09
119 0.09
120 0.11
121 0.11
122 0.09
123 0.09
124 0.09
125 0.09
126 0.1
127 0.1
128 0.09
129 0.08
130 0.07
131 0.07
132 0.07
133 0.09
134 0.08
135 0.08
136 0.07
137 0.07
138 0.07
139 0.08
140 0.07
141 0.05
142 0.05
143 0.07
144 0.07
145 0.07
146 0.07
147 0.06
148 0.06
149 0.06
150 0.06
151 0.05
152 0.04
153 0.05
154 0.05
155 0.05
156 0.04
157 0.05
158 0.05
159 0.05
160 0.05
161 0.05
162 0.05
163 0.05
164 0.05
165 0.05
166 0.04
167 0.05
168 0.07
169 0.09
170 0.12
171 0.12
172 0.13
173 0.13
174 0.15
175 0.15
176 0.13
177 0.13
178 0.13
179 0.15
180 0.14
181 0.14
182 0.14
183 0.14
184 0.14
185 0.12
186 0.09
187 0.07
188 0.06
189 0.06
190 0.06
191 0.06
192 0.07
193 0.1
194 0.11
195 0.14
196 0.15
197 0.15
198 0.17
199 0.2
200 0.27
201 0.26
202 0.27
203 0.25
204 0.25
205 0.24
206 0.22
207 0.19
208 0.11
209 0.1
210 0.09
211 0.09
212 0.08
213 0.08
214 0.08
215 0.08
216 0.07
217 0.07
218 0.08
219 0.06
220 0.06
221 0.07
222 0.07
223 0.07
224 0.07
225 0.09
226 0.08
227 0.09
228 0.1
229 0.09
230 0.08
231 0.1
232 0.11
233 0.11
234 0.11
235 0.1
236 0.11
237 0.12
238 0.11
239 0.11
240 0.14
241 0.15
242 0.15
243 0.15
244 0.15
245 0.16
246 0.16
247 0.17
248 0.14
249 0.18
250 0.17
251 0.16
252 0.16
253 0.15
254 0.15
255 0.14
256 0.11
257 0.05
258 0.06
259 0.05
260 0.05
261 0.05
262 0.04
263 0.04
264 0.04
265 0.04
266 0.03
267 0.03
268 0.03
269 0.04
270 0.04
271 0.04
272 0.04
273 0.04
274 0.06
275 0.06
276 0.06
277 0.05
278 0.05
279 0.06
280 0.07
281 0.07
282 0.06
283 0.07
284 0.07
285 0.07
286 0.08
287 0.07
288 0.07
289 0.06
290 0.06
291 0.05
292 0.06
293 0.06
294 0.06
295 0.06
296 0.07
297 0.09
298 0.11
299 0.12
300 0.12
301 0.12
302 0.12
303 0.13
304 0.16
305 0.2
306 0.18
307 0.19
308 0.19
309 0.19
310 0.19
311 0.19
312 0.15
313 0.14
314 0.16
315 0.23
316 0.27
317 0.31
318 0.38
319 0.44
320 0.52
321 0.57
322 0.65
323 0.69
324 0.75
325 0.81
326 0.84
327 0.86
328 0.84
329 0.85
330 0.84
331 0.82
332 0.8
333 0.81
334 0.78
335 0.75
336 0.7
337 0.64
338 0.61
339 0.61
340 0.53
341 0.44
342 0.46
343 0.48
344 0.5
345 0.51
346 0.48
347 0.42
348 0.41
349 0.44
350 0.36
351 0.32
352 0.27
353 0.23
354 0.2
355 0.16
356 0.15
357 0.12
358 0.11
359 0.08
360 0.08
361 0.08
362 0.07
363 0.07
364 0.08
365 0.08
366 0.09
367 0.09
368 0.09
369 0.08
370 0.09
371 0.09
372 0.11
373 0.18
374 0.25
375 0.31
376 0.34
377 0.38
378 0.4
379 0.39
380 0.4
381 0.34
382 0.3
383 0.26
384 0.23
385 0.19
386 0.17
387 0.16
388 0.14
389 0.11
390 0.07
391 0.05
392 0.06
393 0.05
394 0.05
395 0.05
396 0.05
397 0.06
398 0.06
399 0.06
400 0.06
401 0.08
402 0.09
403 0.09
404 0.09
405 0.08
406 0.13
407 0.15
408 0.18
409 0.19
410 0.22
411 0.24
412 0.28
413 0.29
414 0.29
415 0.3
416 0.32
417 0.34
418 0.39
419 0.41
420 0.42
421 0.44
422 0.38
423 0.37
424 0.32
425 0.27
426 0.19
427 0.17
428 0.16
429 0.16
430 0.21
431 0.23
432 0.26
433 0.31
434 0.39
435 0.4
436 0.46
437 0.54