Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316VKI1

Protein Details
Accession A0A316VKI1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
97-130LAAKVEKASRKLRKERKNRAKKLRGTAKKKGASSBasic
NLS Segment(s)
PositionSequence
93-134VRKGLAAKVEKASRKLRKERKNRAKKLRGTAKKKGASSDKKK
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
Amino Acid Sequences MDATSPVTLRTRKFITNRLLQRRQMVLDVIHPTRANVSKDELQEKLAAMYKANKEQCVVFGMRTHFGGGRSTGFALIYDSRESMNFEPRFRLVRKGLAAKVEKASRKLRKERKNRAKKLRGTAKKKGASSDKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.52
3 0.57
4 0.66
5 0.69
6 0.73
7 0.69
8 0.69
9 0.65
10 0.59
11 0.5
12 0.42
13 0.33
14 0.3
15 0.32
16 0.27
17 0.26
18 0.24
19 0.22
20 0.25
21 0.29
22 0.25
23 0.21
24 0.26
25 0.28
26 0.31
27 0.34
28 0.3
29 0.26
30 0.25
31 0.24
32 0.2
33 0.19
34 0.16
35 0.14
36 0.19
37 0.2
38 0.27
39 0.28
40 0.26
41 0.23
42 0.24
43 0.24
44 0.21
45 0.19
46 0.12
47 0.14
48 0.15
49 0.15
50 0.15
51 0.15
52 0.13
53 0.13
54 0.13
55 0.11
56 0.1
57 0.1
58 0.1
59 0.09
60 0.08
61 0.07
62 0.08
63 0.08
64 0.09
65 0.09
66 0.09
67 0.09
68 0.09
69 0.12
70 0.12
71 0.21
72 0.21
73 0.22
74 0.24
75 0.25
76 0.3
77 0.29
78 0.34
79 0.27
80 0.31
81 0.35
82 0.39
83 0.39
84 0.42
85 0.43
86 0.39
87 0.42
88 0.43
89 0.41
90 0.41
91 0.49
92 0.5
93 0.57
94 0.65
95 0.7
96 0.75
97 0.82
98 0.88
99 0.9
100 0.92
101 0.93
102 0.94
103 0.94
104 0.92
105 0.92
106 0.92
107 0.91
108 0.89
109 0.88
110 0.87
111 0.85
112 0.78
113 0.76
114 0.75