Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316V375

Protein Details
Accession A0A316V375    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
230-256KVAPKNKVAPKKKVASQNKVAPKKKATHydrophilic
NLS Segment(s)
PositionSequence
231-257VAPKNKVAPKKKVASQNKVAPKKKATK
Subcellular Location(s) extr 21, plas 2, mito 1, E.R. 1, golg 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MKAFFFTFAHVLLSAFLLSPLIFAQVQFGIRDVSLPIEPIDYASLAKRAQHTYPYKWPSIDGDLHHMPAEKYFRTAYWTFNATFLHTLRSLAKTDPEKAKDLLYKASVHYNKILQRECWKVSNSSAKAHFRNNTLARVASFPDDDPKHNIDPVYNLVAIVRVTCFERLKGGDVNVPVKRHTKRVVESLRWDKESALRRVNKMHKQFEPKNKAAAPESNVTPKNTATPQNKVAPKNKVAPKKKVASQNKVAPKKKATK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.07
5 0.06
6 0.07
7 0.06
8 0.08
9 0.08
10 0.08
11 0.1
12 0.12
13 0.13
14 0.13
15 0.13
16 0.12
17 0.12
18 0.13
19 0.11
20 0.11
21 0.11
22 0.11
23 0.11
24 0.11
25 0.11
26 0.11
27 0.11
28 0.09
29 0.1
30 0.1
31 0.13
32 0.13
33 0.16
34 0.19
35 0.22
36 0.24
37 0.32
38 0.37
39 0.4
40 0.5
41 0.52
42 0.51
43 0.48
44 0.47
45 0.41
46 0.4
47 0.37
48 0.29
49 0.3
50 0.29
51 0.29
52 0.28
53 0.26
54 0.21
55 0.21
56 0.24
57 0.17
58 0.18
59 0.18
60 0.17
61 0.22
62 0.23
63 0.22
64 0.22
65 0.24
66 0.22
67 0.24
68 0.24
69 0.19
70 0.21
71 0.18
72 0.17
73 0.15
74 0.16
75 0.16
76 0.18
77 0.18
78 0.16
79 0.21
80 0.21
81 0.26
82 0.32
83 0.32
84 0.33
85 0.32
86 0.35
87 0.32
88 0.31
89 0.28
90 0.24
91 0.22
92 0.2
93 0.28
94 0.26
95 0.24
96 0.25
97 0.27
98 0.28
99 0.33
100 0.34
101 0.27
102 0.32
103 0.35
104 0.35
105 0.35
106 0.32
107 0.28
108 0.3
109 0.37
110 0.33
111 0.32
112 0.35
113 0.36
114 0.37
115 0.4
116 0.38
117 0.32
118 0.38
119 0.36
120 0.33
121 0.29
122 0.27
123 0.23
124 0.22
125 0.2
126 0.14
127 0.12
128 0.1
129 0.15
130 0.16
131 0.17
132 0.2
133 0.23
134 0.22
135 0.23
136 0.23
137 0.17
138 0.18
139 0.18
140 0.17
141 0.13
142 0.12
143 0.11
144 0.12
145 0.11
146 0.09
147 0.07
148 0.05
149 0.07
150 0.1
151 0.11
152 0.1
153 0.13
154 0.14
155 0.17
156 0.18
157 0.18
158 0.18
159 0.2
160 0.26
161 0.26
162 0.26
163 0.25
164 0.3
165 0.31
166 0.34
167 0.39
168 0.4
169 0.41
170 0.5
171 0.56
172 0.55
173 0.62
174 0.65
175 0.63
176 0.58
177 0.55
178 0.45
179 0.44
180 0.47
181 0.45
182 0.44
183 0.44
184 0.45
185 0.54
186 0.62
187 0.64
188 0.65
189 0.66
190 0.65
191 0.7
192 0.77
193 0.79
194 0.79
195 0.72
196 0.7
197 0.65
198 0.61
199 0.55
200 0.51
201 0.44
202 0.4
203 0.4
204 0.41
205 0.41
206 0.39
207 0.37
208 0.32
209 0.33
210 0.33
211 0.39
212 0.37
213 0.41
214 0.46
215 0.53
216 0.59
217 0.61
218 0.65
219 0.64
220 0.64
221 0.67
222 0.7
223 0.72
224 0.74
225 0.76
226 0.77
227 0.77
228 0.79
229 0.8
230 0.82
231 0.8
232 0.81
233 0.81
234 0.82
235 0.84
236 0.83
237 0.81