Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316VF58

Protein Details
Accession A0A316VF58    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
78-100RAVGSKRDSRLRRARRAKLYYVRHydrophilic
NLS Segment(s)
PositionSequence
83-95KRDSRLRRARRAK
Subcellular Location(s) mito 10.5, cyto_mito 9.333, cyto_nucl 7.833, nucl 7.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR038657  L19_sf  
IPR001857  Ribosomal_L19  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01245  Ribosomal_L19  
Amino Acid Sequences LFARNSLDRTPPGSIVIVDTWNDMTKTTFTSFSGALIAIRRRGTSTSFVLRNLVNKTGVEMRFNLYSPLIKEIKVVQRAVGSKRDSRLRRARRAKLYYVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.2
4 0.17
5 0.14
6 0.14
7 0.13
8 0.14
9 0.14
10 0.12
11 0.11
12 0.11
13 0.14
14 0.15
15 0.15
16 0.14
17 0.16
18 0.16
19 0.14
20 0.14
21 0.11
22 0.1
23 0.12
24 0.13
25 0.14
26 0.14
27 0.14
28 0.14
29 0.16
30 0.17
31 0.18
32 0.2
33 0.23
34 0.23
35 0.23
36 0.24
37 0.23
38 0.24
39 0.22
40 0.2
41 0.15
42 0.14
43 0.16
44 0.2
45 0.2
46 0.18
47 0.17
48 0.18
49 0.18
50 0.19
51 0.18
52 0.12
53 0.14
54 0.13
55 0.18
56 0.17
57 0.15
58 0.17
59 0.22
60 0.29
61 0.32
62 0.31
63 0.27
64 0.31
65 0.35
66 0.37
67 0.38
68 0.35
69 0.35
70 0.41
71 0.5
72 0.48
73 0.55
74 0.62
75 0.65
76 0.72
77 0.78
78 0.82
79 0.83
80 0.86