Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316VKM5

Protein Details
Accession A0A316VKM5    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
89-108REITPRSKWKRNWDEIRFCSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017136  UCP037205  
Pfam View protein in Pfam  
PF10013  DUF2256  
Amino Acid Sequences MSTQRGYIRLLSTCKVSRNTQLKQPIRAQSTCCRVSSSMPPKRNDRRAITPPSPIQTAKVHTNGGETSTKDDSIDLSKLQAKPCHCCGREITPRSKWKRNWDEIRFCSDQCRSWPGTIKVFTYQGGEDVGSPAGVNMNKVTKPTELEGNSNLEKCINRDEGDPNKETPLGPQHQLLVHELDLDAWIESSIWAVAQQSSKATKLKTLQDVAQVMDDDMDKISDVQLGNAIHEYLKHSHAGLREMIRRAARRLVVMPSESWACSKRNLIGEKVPVLALSQKDGRQRLITLSDVSHAKGEIEVSIDKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.43
4 0.48
5 0.53
6 0.56
7 0.58
8 0.64
9 0.65
10 0.68
11 0.72
12 0.7
13 0.67
14 0.66
15 0.63
16 0.61
17 0.63
18 0.59
19 0.52
20 0.46
21 0.41
22 0.42
23 0.48
24 0.5
25 0.51
26 0.54
27 0.58
28 0.65
29 0.74
30 0.79
31 0.77
32 0.73
33 0.73
34 0.74
35 0.79
36 0.72
37 0.7
38 0.65
39 0.6
40 0.56
41 0.47
42 0.42
43 0.37
44 0.38
45 0.36
46 0.34
47 0.32
48 0.28
49 0.3
50 0.27
51 0.26
52 0.24
53 0.19
54 0.21
55 0.22
56 0.21
57 0.19
58 0.19
59 0.17
60 0.17
61 0.18
62 0.14
63 0.15
64 0.2
65 0.23
66 0.27
67 0.3
68 0.29
69 0.33
70 0.41
71 0.48
72 0.43
73 0.43
74 0.44
75 0.49
76 0.56
77 0.57
78 0.56
79 0.55
80 0.65
81 0.69
82 0.74
83 0.71
84 0.72
85 0.76
86 0.78
87 0.8
88 0.79
89 0.82
90 0.75
91 0.76
92 0.67
93 0.57
94 0.52
95 0.44
96 0.37
97 0.3
98 0.33
99 0.28
100 0.29
101 0.36
102 0.34
103 0.38
104 0.36
105 0.35
106 0.31
107 0.3
108 0.28
109 0.22
110 0.19
111 0.13
112 0.12
113 0.11
114 0.08
115 0.08
116 0.08
117 0.06
118 0.05
119 0.05
120 0.07
121 0.06
122 0.07
123 0.07
124 0.1
125 0.1
126 0.11
127 0.13
128 0.12
129 0.13
130 0.14
131 0.19
132 0.18
133 0.19
134 0.2
135 0.22
136 0.22
137 0.21
138 0.19
139 0.15
140 0.14
141 0.13
142 0.16
143 0.14
144 0.14
145 0.16
146 0.22
147 0.27
148 0.31
149 0.31
150 0.28
151 0.27
152 0.27
153 0.25
154 0.21
155 0.21
156 0.2
157 0.19
158 0.19
159 0.2
160 0.2
161 0.21
162 0.2
163 0.15
164 0.12
165 0.11
166 0.11
167 0.09
168 0.08
169 0.07
170 0.06
171 0.04
172 0.04
173 0.04
174 0.04
175 0.04
176 0.04
177 0.03
178 0.04
179 0.04
180 0.06
181 0.07
182 0.08
183 0.1
184 0.12
185 0.15
186 0.17
187 0.17
188 0.2
189 0.25
190 0.31
191 0.34
192 0.35
193 0.34
194 0.37
195 0.37
196 0.33
197 0.29
198 0.23
199 0.17
200 0.15
201 0.13
202 0.08
203 0.07
204 0.07
205 0.06
206 0.05
207 0.06
208 0.08
209 0.08
210 0.08
211 0.12
212 0.12
213 0.12
214 0.12
215 0.13
216 0.1
217 0.1
218 0.14
219 0.13
220 0.14
221 0.14
222 0.14
223 0.17
224 0.19
225 0.21
226 0.22
227 0.25
228 0.3
229 0.31
230 0.35
231 0.38
232 0.39
233 0.39
234 0.41
235 0.38
236 0.35
237 0.36
238 0.36
239 0.34
240 0.33
241 0.3
242 0.26
243 0.26
244 0.24
245 0.23
246 0.21
247 0.19
248 0.21
249 0.24
250 0.26
251 0.32
252 0.36
253 0.38
254 0.42
255 0.45
256 0.44
257 0.42
258 0.36
259 0.28
260 0.26
261 0.25
262 0.2
263 0.19
264 0.22
265 0.25
266 0.32
267 0.35
268 0.38
269 0.36
270 0.37
271 0.37
272 0.36
273 0.35
274 0.3
275 0.29
276 0.29
277 0.27
278 0.27
279 0.23
280 0.2
281 0.17
282 0.16
283 0.15
284 0.12
285 0.14