Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316V5D7

Protein Details
Accession A0A316V5D7    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
22-47ASEPLQLPPKTKNKKRTPGCFNESTCHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 16, mito 6, nucl 2, plas 2
Family & Domain DBs
Amino Acid Sequences MFFNKNTAAFFILFTFLVTYVASEPLQLPPKTKNKKRTPGCFNESTCAARGGATCFPPAGTNPCMYDSNTPSPCGKLVRCASNSKGNSPYSNPDCGSLIARQGTKVCPSASAPDSSWYGCFSTNTIAGQQNIGAQIMKPLKNAAHSVNTGAKKVMNNVKGVVQKGKDEIHYRTSATQQQAQKHSEKWNPRIDRLANKADDHFYKGDLHLATARSYVDQGGVVKKTAQEQKANEAQYKKHYAKSQVSYAKAIGVGHTAIAAKKVRDTTFRIPGLRGHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.11
4 0.11
5 0.1
6 0.1
7 0.09
8 0.11
9 0.11
10 0.11
11 0.12
12 0.17
13 0.25
14 0.25
15 0.26
16 0.33
17 0.44
18 0.54
19 0.62
20 0.67
21 0.7
22 0.8
23 0.87
24 0.89
25 0.88
26 0.88
27 0.86
28 0.84
29 0.75
30 0.69
31 0.62
32 0.54
33 0.45
34 0.36
35 0.28
36 0.22
37 0.2
38 0.2
39 0.2
40 0.19
41 0.18
42 0.17
43 0.17
44 0.17
45 0.18
46 0.19
47 0.17
48 0.18
49 0.19
50 0.22
51 0.23
52 0.23
53 0.27
54 0.28
55 0.34
56 0.34
57 0.34
58 0.32
59 0.32
60 0.32
61 0.31
62 0.26
63 0.26
64 0.3
65 0.35
66 0.38
67 0.41
68 0.43
69 0.47
70 0.48
71 0.44
72 0.45
73 0.39
74 0.38
75 0.37
76 0.41
77 0.35
78 0.37
79 0.33
80 0.29
81 0.28
82 0.26
83 0.25
84 0.18
85 0.18
86 0.16
87 0.16
88 0.16
89 0.17
90 0.17
91 0.18
92 0.19
93 0.16
94 0.15
95 0.16
96 0.2
97 0.19
98 0.2
99 0.18
100 0.18
101 0.19
102 0.18
103 0.17
104 0.13
105 0.12
106 0.11
107 0.11
108 0.09
109 0.1
110 0.11
111 0.1
112 0.12
113 0.12
114 0.12
115 0.12
116 0.11
117 0.1
118 0.1
119 0.09
120 0.07
121 0.05
122 0.1
123 0.14
124 0.14
125 0.14
126 0.14
127 0.15
128 0.16
129 0.19
130 0.16
131 0.15
132 0.15
133 0.17
134 0.22
135 0.23
136 0.21
137 0.2
138 0.2
139 0.17
140 0.22
141 0.26
142 0.22
143 0.22
144 0.23
145 0.27
146 0.28
147 0.29
148 0.28
149 0.22
150 0.21
151 0.23
152 0.23
153 0.22
154 0.23
155 0.24
156 0.25
157 0.25
158 0.25
159 0.25
160 0.27
161 0.29
162 0.28
163 0.32
164 0.32
165 0.37
166 0.41
167 0.43
168 0.43
169 0.41
170 0.46
171 0.47
172 0.51
173 0.52
174 0.56
175 0.57
176 0.56
177 0.59
178 0.56
179 0.57
180 0.55
181 0.55
182 0.47
183 0.45
184 0.44
185 0.41
186 0.38
187 0.34
188 0.28
189 0.22
190 0.21
191 0.2
192 0.23
193 0.19
194 0.19
195 0.18
196 0.18
197 0.18
198 0.16
199 0.17
200 0.13
201 0.13
202 0.12
203 0.09
204 0.1
205 0.11
206 0.15
207 0.16
208 0.16
209 0.16
210 0.17
211 0.24
212 0.3
213 0.33
214 0.35
215 0.37
216 0.44
217 0.5
218 0.51
219 0.5
220 0.46
221 0.45
222 0.46
223 0.53
224 0.48
225 0.48
226 0.52
227 0.55
228 0.6
229 0.62
230 0.64
231 0.62
232 0.62
233 0.58
234 0.52
235 0.45
236 0.37
237 0.31
238 0.22
239 0.17
240 0.14
241 0.11
242 0.12
243 0.12
244 0.11
245 0.15
246 0.18
247 0.16
248 0.21
249 0.27
250 0.29
251 0.34
252 0.41
253 0.45
254 0.52
255 0.56
256 0.54
257 0.49