Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316V7A0

Protein Details
Accession A0A316V7A0    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
11-36AAKAGGAKKKKWSKGKVKDKSQNMVVHydrophilic
NLS Segment(s)
PositionSequence
5-29KSAIAAAAKAGGAKKKKWSKGKVKD
Subcellular Location(s) mito 12, nucl 8, cyto_mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPKKSAIAAAAKAGGAKKKKWSKGKVKDKSQNMVVLDQPMYDRILKEVPTFKIISQSTLIDRLKINGSLARVAIRHLERDGSIKRVIHHNGQLIYTRTGGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.25
4 0.27
5 0.35
6 0.43
7 0.53
8 0.61
9 0.69
10 0.73
11 0.8
12 0.88
13 0.88
14 0.89
15 0.89
16 0.86
17 0.82
18 0.74
19 0.68
20 0.58
21 0.5
22 0.4
23 0.33
24 0.26
25 0.2
26 0.16
27 0.12
28 0.12
29 0.11
30 0.1
31 0.09
32 0.11
33 0.11
34 0.14
35 0.17
36 0.17
37 0.19
38 0.19
39 0.18
40 0.23
41 0.22
42 0.22
43 0.19
44 0.19
45 0.17
46 0.23
47 0.23
48 0.17
49 0.17
50 0.18
51 0.18
52 0.17
53 0.18
54 0.13
55 0.14
56 0.14
57 0.14
58 0.14
59 0.13
60 0.13
61 0.18
62 0.17
63 0.18
64 0.18
65 0.19
66 0.18
67 0.24
68 0.26
69 0.24
70 0.27
71 0.26
72 0.28
73 0.34
74 0.38
75 0.38
76 0.41
77 0.43
78 0.41
79 0.41
80 0.44
81 0.39
82 0.37