Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316VLT7

Protein Details
Accession A0A316VLT7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
84-104RGPKLPAQPPRKNWKPYVHKTHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 20, E.R. 4, golg 3
Family & Domain DBs
Amino Acid Sequences MLSIKLFHMLLYIVGLIALCKNHSVDASIMFKRFADDSFGSQVVLLEPITVLENPFARRSSHDKKDQSGNSGSGNSGSGSGSDRGPKLPAQPPRKNWKPYVHKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.06
5 0.06
6 0.06
7 0.07
8 0.08
9 0.09
10 0.09
11 0.11
12 0.1
13 0.14
14 0.19
15 0.2
16 0.2
17 0.19
18 0.19
19 0.19
20 0.18
21 0.14
22 0.15
23 0.15
24 0.16
25 0.19
26 0.19
27 0.18
28 0.17
29 0.17
30 0.11
31 0.1
32 0.07
33 0.04
34 0.04
35 0.04
36 0.05
37 0.05
38 0.05
39 0.05
40 0.07
41 0.08
42 0.1
43 0.11
44 0.11
45 0.14
46 0.23
47 0.31
48 0.37
49 0.45
50 0.47
51 0.5
52 0.58
53 0.57
54 0.53
55 0.47
56 0.41
57 0.34
58 0.31
59 0.28
60 0.19
61 0.17
62 0.13
63 0.1
64 0.09
65 0.07
66 0.09
67 0.11
68 0.11
69 0.15
70 0.15
71 0.16
72 0.18
73 0.19
74 0.24
75 0.3
76 0.39
77 0.46
78 0.54
79 0.62
80 0.71
81 0.78
82 0.79
83 0.79
84 0.8