Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316VLJ3

Protein Details
Accession A0A316VLJ3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
109-132NLKTEKSGSTRKTRKSQVKPVEQSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, extr 6, pero 4, golg 3, E.R. 2
Family & Domain DBs
Amino Acid Sequences MQHTFLLKIIFFAIGFKQAFVEASPTPGLGNETPSSGSPSSSKTPAQRTSSQPLKISVSSMDPESKGRHFYEMKKSVRDSSLRRLVEKGEAKNLREASHIRAKKNLQVNLKTEKSGSTRKTRKSQVKPVEQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.15
4 0.15
5 0.14
6 0.15
7 0.13
8 0.16
9 0.1
10 0.13
11 0.13
12 0.13
13 0.12
14 0.12
15 0.15
16 0.11
17 0.15
18 0.13
19 0.14
20 0.15
21 0.15
22 0.19
23 0.16
24 0.17
25 0.14
26 0.18
27 0.2
28 0.22
29 0.25
30 0.26
31 0.33
32 0.39
33 0.43
34 0.45
35 0.47
36 0.52
37 0.55
38 0.53
39 0.48
40 0.43
41 0.4
42 0.35
43 0.3
44 0.23
45 0.18
46 0.15
47 0.15
48 0.14
49 0.11
50 0.13
51 0.14
52 0.14
53 0.16
54 0.15
55 0.19
56 0.21
57 0.25
58 0.34
59 0.41
60 0.42
61 0.43
62 0.44
63 0.42
64 0.43
65 0.43
66 0.37
67 0.38
68 0.44
69 0.42
70 0.41
71 0.4
72 0.37
73 0.4
74 0.42
75 0.35
76 0.35
77 0.38
78 0.38
79 0.43
80 0.43
81 0.35
82 0.33
83 0.32
84 0.29
85 0.36
86 0.39
87 0.35
88 0.41
89 0.43
90 0.46
91 0.53
92 0.53
93 0.52
94 0.53
95 0.57
96 0.58
97 0.58
98 0.52
99 0.44
100 0.42
101 0.39
102 0.42
103 0.43
104 0.46
105 0.52
106 0.6
107 0.69
108 0.75
109 0.8
110 0.82
111 0.86
112 0.86