Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316V747

Protein Details
Accession A0A316V747    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-24AAAKIPIIKKRTKKFARFQSDGFHydrophilic
NLS Segment(s)
PositionSequence
9-50IKKRTKKFARFQSDGFKRVDPSWRKPKGIDSAIRRRFKGRPA
Subcellular Location(s) mito 11cyto 11cyto_mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAAAKIPIIKKRTKKFARFQSDGFKRVDPSWRKPKGIDSAIRRRFKGRPACPKIGYGSNKKTRHLMPNGYRRLVVSNVKDVELLLMHNASYAAEIAHNVSSKKRIEILEKAKVLGVKVTNANARVRAEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.8
3 0.86
4 0.87
5 0.82
6 0.77
7 0.77
8 0.73
9 0.68
10 0.6
11 0.51
12 0.44
13 0.42
14 0.47
15 0.44
16 0.46
17 0.53
18 0.56
19 0.57
20 0.56
21 0.6
22 0.59
23 0.59
24 0.57
25 0.55
26 0.6
27 0.66
28 0.69
29 0.63
30 0.59
31 0.55
32 0.56
33 0.58
34 0.56
35 0.58
36 0.62
37 0.68
38 0.65
39 0.63
40 0.57
41 0.54
42 0.5
43 0.47
44 0.48
45 0.51
46 0.51
47 0.51
48 0.52
49 0.48
50 0.5
51 0.47
52 0.47
53 0.46
54 0.53
55 0.56
56 0.53
57 0.49
58 0.42
59 0.38
60 0.33
61 0.3
62 0.22
63 0.24
64 0.24
65 0.24
66 0.24
67 0.21
68 0.18
69 0.13
70 0.12
71 0.06
72 0.06
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.04
80 0.04
81 0.05
82 0.06
83 0.08
84 0.1
85 0.1
86 0.12
87 0.17
88 0.19
89 0.2
90 0.24
91 0.25
92 0.3
93 0.39
94 0.45
95 0.48
96 0.48
97 0.47
98 0.44
99 0.42
100 0.37
101 0.32
102 0.26
103 0.21
104 0.23
105 0.27
106 0.29
107 0.31
108 0.33
109 0.32
110 0.33