Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316VFP2

Protein Details
Accession A0A316VFP2    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
13-37QGSANSAENRKKRRRTDKREANILAHydrophilic
NLS Segment(s)
PositionSequence
22-30RKKRRRTDK
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR017970  Homeobox_CS  
IPR001356  Homeobox_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
Pfam View protein in Pfam  
PF00046  Homeodomain  
PROSITE View protein in PROSITE  
PS00027  HOMEOBOX_1  
PS50071  HOMEOBOX_2  
CDD cd00086  homeodomain  
Amino Acid Sequences MGEDESGEADISQGSANSAENRKKRRRTDKREANILASVFEQSAFPDVVTREALANSLGMSTRAVSIWFQNRRQAMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.07
4 0.12
5 0.18
6 0.25
7 0.33
8 0.42
9 0.52
10 0.6
11 0.69
12 0.76
13 0.82
14 0.84
15 0.88
16 0.9
17 0.88
18 0.88
19 0.79
20 0.7
21 0.61
22 0.51
23 0.4
24 0.29
25 0.21
26 0.12
27 0.1
28 0.08
29 0.05
30 0.07
31 0.06
32 0.06
33 0.07
34 0.07
35 0.09
36 0.09
37 0.1
38 0.09
39 0.09
40 0.09
41 0.08
42 0.08
43 0.06
44 0.06
45 0.06
46 0.06
47 0.06
48 0.07
49 0.07
50 0.07
51 0.08
52 0.09
53 0.15
54 0.25
55 0.32
56 0.34
57 0.41