Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316VBN8

Protein Details
Accession A0A316VBN8   
Localization Confidence High
Confidence Score 19.7
NoLS Segment(s)
PositionSequenceProtein Nature
195-221ANDFPQMSSRRRRKKKNPKGPQTGSAAHydrophilic
247-272KGPQEPSKALPKKQRARKLTLPPYHEHydrophilic
NLS Segment(s)
PositionSequence
134-139ARRHEK
182-214RARRRAARNIKKEANDFPQMSSRRRRKKKNPKG
254-263KALPKKQRAR
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:1902555  C:endoribonuclease complex  
GO:1990904  C:ribonucleoprotein complex  
GO:0034470  P:ncRNA processing  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences MAKEGKINAQGAKAQPLRVAQHESVHTLNAILQQSAFASVNSILKGNLPPSSARKGCQYLQSLARKATLRLDVSVKRSICKRCHSFLLPGISCTIRVRPSKPCDLVLVRRCTICGTSRRLPCPAVQSKRFKALARRHEKRQANIDSRKVSKKVETATQGAIIVDENGVLCTAEAESGRLSQRARRRAARNIKKEANDFPQMSSRRRRKKKNPKGPQTGSAADVSLLSTTTQSTEPKTSSALHSNKVKGPQEPSKALPKKQRARKLTLPPYHERVQSTSSSESLWKHDIPNEASEAERQALSTLRGDHIVTVGLGKGGIVGDRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.38
4 0.38
5 0.38
6 0.43
7 0.35
8 0.38
9 0.39
10 0.39
11 0.35
12 0.32
13 0.28
14 0.21
15 0.21
16 0.2
17 0.19
18 0.16
19 0.15
20 0.14
21 0.14
22 0.17
23 0.15
24 0.1
25 0.11
26 0.12
27 0.15
28 0.15
29 0.15
30 0.12
31 0.14
32 0.17
33 0.17
34 0.17
35 0.16
36 0.19
37 0.24
38 0.33
39 0.33
40 0.32
41 0.37
42 0.4
43 0.42
44 0.46
45 0.45
46 0.42
47 0.48
48 0.55
49 0.51
50 0.47
51 0.49
52 0.43
53 0.39
54 0.39
55 0.37
56 0.3
57 0.3
58 0.35
59 0.34
60 0.37
61 0.43
62 0.38
63 0.35
64 0.4
65 0.46
66 0.46
67 0.51
68 0.53
69 0.51
70 0.57
71 0.58
72 0.56
73 0.54
74 0.57
75 0.47
76 0.41
77 0.39
78 0.32
79 0.29
80 0.25
81 0.23
82 0.2
83 0.23
84 0.26
85 0.33
86 0.39
87 0.47
88 0.48
89 0.46
90 0.45
91 0.47
92 0.52
93 0.51
94 0.51
95 0.43
96 0.41
97 0.4
98 0.36
99 0.32
100 0.29
101 0.27
102 0.29
103 0.35
104 0.41
105 0.44
106 0.45
107 0.44
108 0.41
109 0.44
110 0.46
111 0.46
112 0.48
113 0.53
114 0.53
115 0.59
116 0.6
117 0.53
118 0.53
119 0.55
120 0.58
121 0.6
122 0.63
123 0.63
124 0.69
125 0.71
126 0.66
127 0.66
128 0.64
129 0.63
130 0.63
131 0.62
132 0.57
133 0.57
134 0.57
135 0.5
136 0.43
137 0.37
138 0.35
139 0.32
140 0.32
141 0.31
142 0.29
143 0.27
144 0.26
145 0.23
146 0.18
147 0.16
148 0.11
149 0.07
150 0.05
151 0.04
152 0.03
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.03
159 0.04
160 0.04
161 0.04
162 0.05
163 0.07
164 0.08
165 0.1
166 0.1
167 0.15
168 0.23
169 0.3
170 0.35
171 0.41
172 0.46
173 0.55
174 0.66
175 0.71
176 0.72
177 0.73
178 0.73
179 0.69
180 0.66
181 0.61
182 0.56
183 0.51
184 0.43
185 0.36
186 0.38
187 0.38
188 0.4
189 0.45
190 0.49
191 0.54
192 0.63
193 0.73
194 0.76
195 0.85
196 0.91
197 0.92
198 0.93
199 0.93
200 0.95
201 0.89
202 0.83
203 0.77
204 0.67
205 0.58
206 0.47
207 0.36
208 0.25
209 0.2
210 0.14
211 0.08
212 0.07
213 0.06
214 0.05
215 0.05
216 0.07
217 0.09
218 0.1
219 0.13
220 0.16
221 0.17
222 0.17
223 0.2
224 0.2
225 0.22
226 0.3
227 0.3
228 0.33
229 0.38
230 0.41
231 0.43
232 0.49
233 0.48
234 0.42
235 0.47
236 0.49
237 0.5
238 0.5
239 0.5
240 0.53
241 0.57
242 0.6
243 0.62
244 0.64
245 0.68
246 0.74
247 0.8
248 0.76
249 0.79
250 0.82
251 0.83
252 0.83
253 0.8
254 0.77
255 0.74
256 0.73
257 0.7
258 0.64
259 0.55
260 0.48
261 0.44
262 0.4
263 0.38
264 0.34
265 0.29
266 0.27
267 0.28
268 0.26
269 0.27
270 0.28
271 0.26
272 0.26
273 0.3
274 0.35
275 0.35
276 0.36
277 0.34
278 0.3
279 0.29
280 0.28
281 0.26
282 0.21
283 0.18
284 0.15
285 0.14
286 0.15
287 0.16
288 0.18
289 0.18
290 0.18
291 0.2
292 0.2
293 0.2
294 0.18
295 0.17
296 0.13
297 0.12
298 0.11
299 0.09
300 0.08
301 0.07
302 0.07
303 0.07