Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316VST5

Protein Details
Accession A0A316VST5   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
45-90PRKFARETKPTPKRTRGPKKTYEEKLQNDRERKRRFYQNNTEHQKKBasic
NLS Segment(s)
PositionSequence
47-66KFARETKPTPKRTRGPKKTY
76-77RK
Subcellular Location(s) nucl 7.5, mito 6, cyto_nucl 5, extr 3, pero 3, golg 3, plas 2
Family & Domain DBs
Amino Acid Sequences MRNDMFLGLFLSLVCLSTLTFPIPVRIIVDADYESDQDNPWLSVPRKFARETKPTPKRTRGPKKTYEEKLQNDRERKRRFYQNNTEHQKKMHQASYLRRKADPLRVKHDLATRKIYREANREKISSYQREYYLRRKAEAEAKKRQAADSVEMSIQLESQKKRKLDTIVAEGSESHRSANTHAKKQRASSPKGNTEAKPSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.09
5 0.1
6 0.09
7 0.12
8 0.12
9 0.15
10 0.16
11 0.16
12 0.15
13 0.15
14 0.15
15 0.13
16 0.15
17 0.12
18 0.13
19 0.14
20 0.13
21 0.12
22 0.12
23 0.12
24 0.11
25 0.11
26 0.1
27 0.1
28 0.17
29 0.18
30 0.22
31 0.28
32 0.32
33 0.35
34 0.38
35 0.44
36 0.46
37 0.54
38 0.57
39 0.62
40 0.68
41 0.73
42 0.78
43 0.8
44 0.79
45 0.81
46 0.84
47 0.84
48 0.83
49 0.83
50 0.83
51 0.84
52 0.83
53 0.81
54 0.78
55 0.75
56 0.75
57 0.75
58 0.73
59 0.72
60 0.74
61 0.74
62 0.72
63 0.72
64 0.69
65 0.71
66 0.72
67 0.73
68 0.76
69 0.75
70 0.78
71 0.8
72 0.78
73 0.68
74 0.61
75 0.56
76 0.49
77 0.45
78 0.38
79 0.34
80 0.34
81 0.42
82 0.52
83 0.53
84 0.49
85 0.45
86 0.45
87 0.44
88 0.49
89 0.47
90 0.42
91 0.43
92 0.46
93 0.46
94 0.46
95 0.48
96 0.44
97 0.4
98 0.43
99 0.38
100 0.36
101 0.41
102 0.43
103 0.41
104 0.45
105 0.49
106 0.5
107 0.51
108 0.5
109 0.46
110 0.47
111 0.49
112 0.45
113 0.41
114 0.36
115 0.36
116 0.41
117 0.45
118 0.47
119 0.49
120 0.46
121 0.43
122 0.41
123 0.42
124 0.46
125 0.5
126 0.49
127 0.51
128 0.55
129 0.57
130 0.56
131 0.53
132 0.48
133 0.42
134 0.39
135 0.31
136 0.28
137 0.23
138 0.23
139 0.23
140 0.17
141 0.15
142 0.14
143 0.17
144 0.18
145 0.25
146 0.32
147 0.33
148 0.36
149 0.41
150 0.43
151 0.46
152 0.48
153 0.49
154 0.46
155 0.45
156 0.42
157 0.37
158 0.34
159 0.3
160 0.24
161 0.17
162 0.15
163 0.15
164 0.19
165 0.29
166 0.35
167 0.41
168 0.47
169 0.55
170 0.57
171 0.62
172 0.68
173 0.67
174 0.67
175 0.67
176 0.71
177 0.71
178 0.74
179 0.75
180 0.67