Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316V2Z0

Protein Details
Accession A0A316V2Z0    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
27-60KQMIFCKSKCHKNFKMKRNPRKVRWTKAFRKAAGHydrophilic
NLS Segment(s)
PositionSequence
41-59KMKRNPRKVRWTKAFRKAA
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR023442  Ribosomal_L24e_CS  
IPR011017  TRASH_dom  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
PROSITE View protein in PROSITE  
PS01073  RIBOSOMAL_L24E  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MQIRHCFFCSSAVYPGRGIMFVRNDAKQMIFCKSKCHKNFKMKRNPRKVRWTKAFRKAAGKEMTVDSTLEFEKRRNVPVRYNRELVQQTLVAMDRIAEIRARREAAFYRARMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.27
4 0.23
5 0.21
6 0.18
7 0.19
8 0.22
9 0.26
10 0.24
11 0.25
12 0.25
13 0.25
14 0.23
15 0.23
16 0.24
17 0.26
18 0.26
19 0.34
20 0.4
21 0.5
22 0.54
23 0.61
24 0.64
25 0.7
26 0.79
27 0.81
28 0.85
29 0.86
30 0.89
31 0.91
32 0.91
33 0.88
34 0.9
35 0.88
36 0.87
37 0.86
38 0.85
39 0.83
40 0.84
41 0.82
42 0.73
43 0.73
44 0.64
45 0.62
46 0.55
47 0.46
48 0.37
49 0.32
50 0.3
51 0.22
52 0.2
53 0.12
54 0.11
55 0.11
56 0.11
57 0.1
58 0.1
59 0.17
60 0.19
61 0.25
62 0.31
63 0.34
64 0.42
65 0.52
66 0.6
67 0.58
68 0.6
69 0.54
70 0.55
71 0.53
72 0.45
73 0.38
74 0.29
75 0.24
76 0.23
77 0.22
78 0.14
79 0.12
80 0.1
81 0.09
82 0.09
83 0.1
84 0.11
85 0.12
86 0.17
87 0.21
88 0.24
89 0.23
90 0.27
91 0.3
92 0.34
93 0.41