Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316VDB1

Protein Details
Accession A0A316VDB1    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
132-155DQTIVDWRKQRKDVKTKAKPKLPFHydrophilic
NLS Segment(s)
PositionSequence
140-152KQRKDVKTKAKPK
Subcellular Location(s) nucl 23, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR037507  MrpL25  
IPR040922  MRPL25_dom  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF18126  Mitoc_mL59  
Amino Acid Sequences MGEANNLSEKKGNAQKYSYYNQRAINPHPFKLFHNRTTGKYINPRLSLRRQAQLGKQAFAEGRFDELIQQIDRLNFGNEYYAGEKLNKMRSRIAEIKAEEQDLQQKAMSGELEQMKGPKRRQNITDRLSKMDQTIVDWRKQRKDVKTKAKPKLPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.46
3 0.49
4 0.56
5 0.57
6 0.55
7 0.54
8 0.54
9 0.58
10 0.57
11 0.56
12 0.6
13 0.55
14 0.52
15 0.51
16 0.48
17 0.45
18 0.51
19 0.51
20 0.45
21 0.5
22 0.5
23 0.49
24 0.55
25 0.54
26 0.49
27 0.52
28 0.54
29 0.51
30 0.53
31 0.53
32 0.51
33 0.56
34 0.59
35 0.53
36 0.51
37 0.48
38 0.47
39 0.48
40 0.51
41 0.46
42 0.38
43 0.34
44 0.31
45 0.28
46 0.24
47 0.22
48 0.12
49 0.12
50 0.11
51 0.11
52 0.1
53 0.11
54 0.12
55 0.1
56 0.1
57 0.09
58 0.09
59 0.1
60 0.1
61 0.09
62 0.08
63 0.08
64 0.08
65 0.07
66 0.08
67 0.09
68 0.09
69 0.09
70 0.09
71 0.1
72 0.13
73 0.22
74 0.23
75 0.24
76 0.27
77 0.28
78 0.35
79 0.4
80 0.39
81 0.37
82 0.36
83 0.38
84 0.35
85 0.35
86 0.27
87 0.22
88 0.26
89 0.21
90 0.2
91 0.16
92 0.16
93 0.15
94 0.16
95 0.15
96 0.09
97 0.13
98 0.14
99 0.15
100 0.14
101 0.18
102 0.23
103 0.3
104 0.35
105 0.36
106 0.41
107 0.47
108 0.54
109 0.61
110 0.64
111 0.63
112 0.68
113 0.64
114 0.63
115 0.59
116 0.53
117 0.44
118 0.38
119 0.33
120 0.27
121 0.34
122 0.32
123 0.36
124 0.42
125 0.47
126 0.52
127 0.6
128 0.64
129 0.65
130 0.72
131 0.77
132 0.81
133 0.85
134 0.88
135 0.9