Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316VB99

Protein Details
Accession A0A316VB99    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
14-44VKGQCPKVEKQEKPKQPKGRAHKRLLYNRRFBasic
NLS Segment(s)
PositionSequence
20-37KVEKQEKPKQPKGRAHKR
Subcellular Location(s) nucl 12, mito 11, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKGQCPKVEKQEKPKQPKGRAHKRLLYNRRFVNVVLGPSGKRKANAQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.42
4 0.42
5 0.45
6 0.52
7 0.56
8 0.61
9 0.61
10 0.64
11 0.69
12 0.74
13 0.78
14 0.8
15 0.79
16 0.78
17 0.81
18 0.82
19 0.83
20 0.83
21 0.8
22 0.78
23 0.78
24 0.8
25 0.81
26 0.77
27 0.74
28 0.68
29 0.63
30 0.57
31 0.47
32 0.44
33 0.37
34 0.31
35 0.26
36 0.25
37 0.23
38 0.27
39 0.32
40 0.27
41 0.26