Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316V4X9

Protein Details
Accession A0A316V4X9    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGKRKKATKPQAAKKVQPLDVHydrophilic
NLS Segment(s)
PositionSequence
4-9RKKATK
Subcellular Location(s) mito 12.5, cyto_mito 10.5, cyto 7.5, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKATKPQAAKKVQPLDVVFKCLFCKHEKAVNCKIADGQANLECKVCGQRFSCRTNSLTAPIDVYSEWIDATEEVNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.8
3 0.72
4 0.66
5 0.58
6 0.56
7 0.49
8 0.48
9 0.39
10 0.31
11 0.3
12 0.26
13 0.26
14 0.21
15 0.25
16 0.23
17 0.29
18 0.33
19 0.39
20 0.45
21 0.49
22 0.45
23 0.41
24 0.38
25 0.34
26 0.31
27 0.24
28 0.17
29 0.15
30 0.16
31 0.16
32 0.16
33 0.14
34 0.12
35 0.18
36 0.16
37 0.17
38 0.18
39 0.27
40 0.32
41 0.37
42 0.41
43 0.39
44 0.4
45 0.4
46 0.4
47 0.36
48 0.33
49 0.29
50 0.26
51 0.22
52 0.22
53 0.17
54 0.17
55 0.14
56 0.11
57 0.11
58 0.09
59 0.1
60 0.09