Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316VHU0

Protein Details
Accession A0A316VHU0    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
51-70ACGKLFKRPQDLKKHERIHTBasic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 9, cyto_nucl 8.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences HLCNDHVGRKSTNNLCLSCKWEGCDVTCAKRDHITSHLRVHTPLKPHACDACGKLFKRPQDLKKHERIHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.46
3 0.45
4 0.45
5 0.41
6 0.36
7 0.3
8 0.29
9 0.28
10 0.25
11 0.29
12 0.27
13 0.27
14 0.32
15 0.31
16 0.29
17 0.31
18 0.3
19 0.26
20 0.3
21 0.31
22 0.29
23 0.33
24 0.35
25 0.32
26 0.33
27 0.34
28 0.32
29 0.31
30 0.34
31 0.34
32 0.32
33 0.34
34 0.35
35 0.32
36 0.32
37 0.3
38 0.32
39 0.34
40 0.34
41 0.39
42 0.43
43 0.46
44 0.54
45 0.6
46 0.6
47 0.64
48 0.73
49 0.74
50 0.79