Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316VAL8

Protein Details
Accession A0A316VAL8    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
46-72EKLHKAPRPKSLKQRRNERKNLTNPNSHydrophilic
NLS Segment(s)
PositionSequence
50-64KAPRPKSLKQRRNER
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039355  Transcription_factor_GATA  
IPR000679  Znf_GATA  
IPR013088  Znf_NHR/GATA  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
GO:0008270  F:zinc ion binding  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00320  GATA  
PROSITE View protein in PROSITE  
PS00344  GATA_ZN_FINGER_1  
PS50114  GATA_ZN_FINGER_2  
CDD cd00202  ZnF_GATA  
Amino Acid Sequences MQLGQDNDSDVKRAKPQCVNCGATKTPLWRRDANFELQCNACGLYEKLHKAPRPKSLKQRRNERKNLTNPNSSPDHQGAACANCGTSTTPLWRKDREGRIICNACGLYYKLHNSHRPVTMRMDAIKRRSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.44
3 0.5
4 0.56
5 0.62
6 0.63
7 0.57
8 0.58
9 0.52
10 0.47
11 0.43
12 0.43
13 0.43
14 0.45
15 0.47
16 0.47
17 0.49
18 0.53
19 0.53
20 0.54
21 0.49
22 0.45
23 0.43
24 0.37
25 0.34
26 0.27
27 0.24
28 0.15
29 0.13
30 0.12
31 0.13
32 0.17
33 0.19
34 0.23
35 0.28
36 0.32
37 0.38
38 0.43
39 0.48
40 0.52
41 0.56
42 0.63
43 0.69
44 0.74
45 0.74
46 0.8
47 0.81
48 0.83
49 0.86
50 0.82
51 0.8
52 0.82
53 0.84
54 0.78
55 0.74
56 0.64
57 0.59
58 0.55
59 0.46
60 0.41
61 0.31
62 0.27
63 0.2
64 0.21
65 0.18
66 0.15
67 0.15
68 0.11
69 0.1
70 0.08
71 0.09
72 0.09
73 0.09
74 0.1
75 0.16
76 0.23
77 0.29
78 0.33
79 0.35
80 0.4
81 0.48
82 0.54
83 0.58
84 0.57
85 0.55
86 0.61
87 0.62
88 0.56
89 0.51
90 0.42
91 0.32
92 0.29
93 0.26
94 0.19
95 0.2
96 0.25
97 0.28
98 0.35
99 0.41
100 0.45
101 0.5
102 0.54
103 0.54
104 0.52
105 0.52
106 0.5
107 0.47
108 0.47
109 0.5
110 0.49