Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316VD12

Protein Details
Accession A0A316VD12   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
42-70EGQNGSSASKKKKKNKSGSAKKKAKALRAHydrophilic
NLS Segment(s)
PositionSequence
50-69SKKKKKNKSGSAKKKAKALR
Subcellular Location(s) nucl 14.5, cyto_nucl 14, cyto 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036005  Creatinase/aminopeptidase-like  
IPR000994  Pept_M24  
IPR001714  Pept_M24_MAP  
IPR002468  Pept_M24A_MAP2  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0046872  F:metal ion binding  
GO:0070006  F:metalloaminopeptidase activity  
GO:0070084  P:protein initiator methionine removal  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF00557  Peptidase_M24  
CDD cd01088  MetAP2  
Amino Acid Sequences MTTEIGKANGGGKEEAELSKTLEQAQLNGGSNGAAADGAGAEGQNGSSASKKKKKNKSGSAKKKAKALRAAGVSSVKQTEPPSIGLSKMFVDGCYPVGEMQDYDESKFDENRKRETEAEKKERYRLLQEGEGNSLDNIRRAAEAHRQVRQYAQKAIKPGMSMTDIANMIEDGVRTVVEAEGMERGIGFPTGLSLNEVAAHYTPNAGDKRILQSGDVLKVDIGIQVKGRICDSAFTLTFDESKKWDPLLDAVRAATNAGIQASGIDARLGEIGASIQEVMESHEFDVDGKTQHVKCVRNLNGHSIEKYSIHGKKSVPIVAVPNLDTKMEEGEYFAIETFGTTGRGVVVDAGDCSHYARRGNPNHSNFRVSSARPLLHAINKHFGSLPFCRRYLDRVGEKNYLLGLRHLVQLGVVQDYPPLTDIPGSMTAQFEHTIFLGPSKKEVVSRGEDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.18
4 0.17
5 0.18
6 0.2
7 0.21
8 0.21
9 0.23
10 0.23
11 0.22
12 0.25
13 0.27
14 0.26
15 0.25
16 0.23
17 0.18
18 0.18
19 0.16
20 0.12
21 0.06
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.05
32 0.05
33 0.06
34 0.12
35 0.19
36 0.29
37 0.38
38 0.48
39 0.58
40 0.69
41 0.79
42 0.85
43 0.89
44 0.9
45 0.93
46 0.94
47 0.95
48 0.94
49 0.87
50 0.84
51 0.8
52 0.77
53 0.75
54 0.69
55 0.65
56 0.6
57 0.58
58 0.52
59 0.49
60 0.41
61 0.35
62 0.31
63 0.24
64 0.22
65 0.23
66 0.23
67 0.22
68 0.23
69 0.24
70 0.23
71 0.24
72 0.21
73 0.21
74 0.17
75 0.18
76 0.16
77 0.12
78 0.13
79 0.12
80 0.13
81 0.13
82 0.12
83 0.1
84 0.1
85 0.11
86 0.09
87 0.11
88 0.16
89 0.15
90 0.16
91 0.16
92 0.17
93 0.18
94 0.23
95 0.28
96 0.31
97 0.34
98 0.41
99 0.44
100 0.46
101 0.49
102 0.53
103 0.56
104 0.58
105 0.64
106 0.65
107 0.65
108 0.67
109 0.67
110 0.62
111 0.57
112 0.52
113 0.47
114 0.44
115 0.44
116 0.4
117 0.38
118 0.35
119 0.29
120 0.24
121 0.22
122 0.16
123 0.13
124 0.12
125 0.1
126 0.1
127 0.11
128 0.15
129 0.21
130 0.3
131 0.33
132 0.38
133 0.39
134 0.39
135 0.45
136 0.48
137 0.43
138 0.43
139 0.44
140 0.41
141 0.43
142 0.45
143 0.39
144 0.33
145 0.29
146 0.23
147 0.19
148 0.17
149 0.14
150 0.16
151 0.14
152 0.13
153 0.13
154 0.1
155 0.09
156 0.08
157 0.08
158 0.04
159 0.04
160 0.04
161 0.04
162 0.05
163 0.04
164 0.04
165 0.04
166 0.04
167 0.05
168 0.05
169 0.05
170 0.04
171 0.05
172 0.05
173 0.05
174 0.04
175 0.03
176 0.04
177 0.05
178 0.05
179 0.06
180 0.05
181 0.06
182 0.07
183 0.07
184 0.07
185 0.06
186 0.07
187 0.06
188 0.06
189 0.06
190 0.1
191 0.11
192 0.11
193 0.12
194 0.13
195 0.16
196 0.18
197 0.18
198 0.14
199 0.17
200 0.18
201 0.2
202 0.19
203 0.15
204 0.12
205 0.13
206 0.13
207 0.11
208 0.09
209 0.07
210 0.07
211 0.1
212 0.11
213 0.12
214 0.12
215 0.1
216 0.1
217 0.1
218 0.11
219 0.12
220 0.11
221 0.12
222 0.13
223 0.12
224 0.14
225 0.14
226 0.14
227 0.12
228 0.14
229 0.14
230 0.13
231 0.14
232 0.12
233 0.16
234 0.19
235 0.18
236 0.16
237 0.15
238 0.15
239 0.15
240 0.14
241 0.1
242 0.06
243 0.05
244 0.05
245 0.04
246 0.04
247 0.04
248 0.04
249 0.04
250 0.04
251 0.04
252 0.04
253 0.04
254 0.04
255 0.04
256 0.04
257 0.03
258 0.03
259 0.03
260 0.04
261 0.03
262 0.03
263 0.03
264 0.03
265 0.06
266 0.06
267 0.07
268 0.07
269 0.08
270 0.08
271 0.08
272 0.09
273 0.08
274 0.08
275 0.09
276 0.15
277 0.15
278 0.19
279 0.25
280 0.27
281 0.3
282 0.39
283 0.43
284 0.45
285 0.47
286 0.5
287 0.51
288 0.5
289 0.47
290 0.38
291 0.35
292 0.27
293 0.28
294 0.28
295 0.25
296 0.25
297 0.28
298 0.27
299 0.3
300 0.34
301 0.35
302 0.28
303 0.26
304 0.28
305 0.27
306 0.28
307 0.24
308 0.22
309 0.2
310 0.19
311 0.17
312 0.14
313 0.13
314 0.12
315 0.11
316 0.09
317 0.09
318 0.1
319 0.1
320 0.09
321 0.07
322 0.06
323 0.07
324 0.06
325 0.06
326 0.07
327 0.07
328 0.07
329 0.07
330 0.07
331 0.07
332 0.07
333 0.07
334 0.06
335 0.06
336 0.07
337 0.07
338 0.07
339 0.09
340 0.11
341 0.13
342 0.15
343 0.21
344 0.3
345 0.38
346 0.47
347 0.55
348 0.61
349 0.68
350 0.69
351 0.68
352 0.58
353 0.56
354 0.53
355 0.44
356 0.45
357 0.42
358 0.39
359 0.35
360 0.38
361 0.36
362 0.37
363 0.41
364 0.37
365 0.39
366 0.39
367 0.39
368 0.37
369 0.35
370 0.35
371 0.37
372 0.42
373 0.39
374 0.39
375 0.4
376 0.4
377 0.43
378 0.46
379 0.48
380 0.48
381 0.51
382 0.56
383 0.59
384 0.57
385 0.53
386 0.47
387 0.39
388 0.31
389 0.25
390 0.23
391 0.2
392 0.22
393 0.21
394 0.19
395 0.16
396 0.18
397 0.17
398 0.16
399 0.14
400 0.11
401 0.12
402 0.13
403 0.13
404 0.12
405 0.11
406 0.09
407 0.1
408 0.1
409 0.13
410 0.17
411 0.17
412 0.17
413 0.18
414 0.18
415 0.19
416 0.2
417 0.16
418 0.13
419 0.13
420 0.15
421 0.14
422 0.18
423 0.22
424 0.22
425 0.25
426 0.28
427 0.29
428 0.29
429 0.34
430 0.35