Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316VHS3

Protein Details
Accession A0A316VHS3   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
110-134LEHAEKKRNRIKSSKRRIRPSETPIBasic
NLS Segment(s)
PositionSequence
115-128KKRNRIKSSKRRIR
Subcellular Location(s) mito 12, nucl 11.5, cyto_nucl 8, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003108  GAR_dom  
IPR036534  GAR_dom_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005856  C:cytoskeleton  
GO:0008017  F:microtubule binding  
Pfam View protein in Pfam  
PF02187  GAS2  
PROSITE View protein in PROSITE  
PS51460  GAR  
Amino Acid Sequences MQKDEVSLLNSTNIIISTCKYKNIMTDIVKRIKDQIKLAESAQSHWDIARLNIEFKSLEPVVSDINKRVRPTFGKPIDDLDLYVLAGDANVAYITLYDTIIAQQDKILALEHAEKKRNRIKSSKRRIRPSETPIPTVSEHPEVSIAPNSSDSEGISIVKRTSKAPNSSDSEGYSTVKQTSNGTISSKGSQATLDAEVAKVVKQVSTKLHFKRASPLTPKKQSTPSLSGKYLVGPPDSNQPKLCFCRIFNNNVMVRVGGGWDHLSTYLNRHFGYLATSPPDSPSQSRTTTPERHSPDHSFRSEGTMRELSMSLSPESIKQFLRKQESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.18
5 0.19
6 0.22
7 0.24
8 0.25
9 0.29
10 0.34
11 0.41
12 0.4
13 0.48
14 0.53
15 0.59
16 0.59
17 0.55
18 0.58
19 0.56
20 0.54
21 0.5
22 0.5
23 0.46
24 0.47
25 0.47
26 0.44
27 0.39
28 0.36
29 0.34
30 0.27
31 0.23
32 0.2
33 0.22
34 0.16
35 0.17
36 0.21
37 0.18
38 0.19
39 0.19
40 0.2
41 0.19
42 0.18
43 0.23
44 0.17
45 0.16
46 0.15
47 0.15
48 0.17
49 0.21
50 0.22
51 0.21
52 0.29
53 0.33
54 0.34
55 0.35
56 0.38
57 0.4
58 0.46
59 0.51
60 0.5
61 0.5
62 0.49
63 0.51
64 0.47
65 0.42
66 0.35
67 0.25
68 0.19
69 0.14
70 0.13
71 0.09
72 0.06
73 0.05
74 0.05
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.04
82 0.05
83 0.05
84 0.05
85 0.05
86 0.06
87 0.09
88 0.09
89 0.08
90 0.08
91 0.09
92 0.09
93 0.09
94 0.09
95 0.06
96 0.08
97 0.15
98 0.21
99 0.25
100 0.32
101 0.33
102 0.4
103 0.47
104 0.54
105 0.52
106 0.56
107 0.63
108 0.67
109 0.77
110 0.8
111 0.82
112 0.84
113 0.86
114 0.84
115 0.82
116 0.79
117 0.78
118 0.7
119 0.65
120 0.55
121 0.51
122 0.43
123 0.36
124 0.31
125 0.23
126 0.19
127 0.16
128 0.16
129 0.13
130 0.14
131 0.15
132 0.12
133 0.1
134 0.11
135 0.11
136 0.11
137 0.11
138 0.09
139 0.07
140 0.07
141 0.08
142 0.07
143 0.08
144 0.08
145 0.09
146 0.1
147 0.12
148 0.18
149 0.23
150 0.28
151 0.29
152 0.34
153 0.37
154 0.38
155 0.37
156 0.31
157 0.28
158 0.23
159 0.23
160 0.18
161 0.14
162 0.14
163 0.14
164 0.14
165 0.13
166 0.14
167 0.15
168 0.16
169 0.16
170 0.16
171 0.16
172 0.17
173 0.17
174 0.15
175 0.13
176 0.12
177 0.11
178 0.11
179 0.1
180 0.09
181 0.08
182 0.08
183 0.08
184 0.08
185 0.08
186 0.07
187 0.07
188 0.08
189 0.08
190 0.11
191 0.17
192 0.22
193 0.3
194 0.32
195 0.41
196 0.42
197 0.42
198 0.48
199 0.49
200 0.51
201 0.53
202 0.6
203 0.6
204 0.67
205 0.68
206 0.64
207 0.65
208 0.63
209 0.6
210 0.58
211 0.56
212 0.53
213 0.51
214 0.48
215 0.41
216 0.38
217 0.33
218 0.27
219 0.21
220 0.17
221 0.17
222 0.26
223 0.29
224 0.29
225 0.29
226 0.3
227 0.34
228 0.38
229 0.42
230 0.35
231 0.34
232 0.42
233 0.44
234 0.47
235 0.45
236 0.49
237 0.45
238 0.43
239 0.41
240 0.31
241 0.27
242 0.21
243 0.17
244 0.09
245 0.08
246 0.07
247 0.07
248 0.08
249 0.08
250 0.09
251 0.09
252 0.15
253 0.19
254 0.22
255 0.22
256 0.22
257 0.22
258 0.21
259 0.25
260 0.21
261 0.19
262 0.19
263 0.2
264 0.2
265 0.22
266 0.25
267 0.23
268 0.24
269 0.26
270 0.28
271 0.3
272 0.33
273 0.36
274 0.41
275 0.47
276 0.49
277 0.54
278 0.56
279 0.57
280 0.61
281 0.64
282 0.65
283 0.64
284 0.61
285 0.55
286 0.48
287 0.52
288 0.49
289 0.42
290 0.39
291 0.34
292 0.31
293 0.31
294 0.3
295 0.24
296 0.23
297 0.24
298 0.18
299 0.17
300 0.18
301 0.19
302 0.22
303 0.24
304 0.25
305 0.29
306 0.35
307 0.43